General Information of Drug-Metabolizing Enzyme (DME) (ID: DE073H6)

DME Name Prostaglandin G/H synthase 1 (COX-1)
Synonyms Prostaglandin H2 synthase 1; Prostaglandin-endoperoxide synthase 1; Cyclooxygenase-1; PGH synthase 1; COX-1; COX1; PGHS-1; PHS 1; PTGS1
Gene Name PTGS1
UniProt ID
PGH1_HUMAN
INTEDE ID
DME0091
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5742
EC Number EC: 1.14.99.1
Oxidoreductase
Oxygen paired donor oxidoreductase
Oxygen paired donor oxidoreductase
EC: 1.14.99.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
Function This enzyme converts arachidonate to prostaglandin H2 (PGH2).
KEGG Pathway
Arachidonic acid metabolism (hsa00590 )
Metabolic pathways (hsa01100 )
Platelet activation (hsa04611 )
Regulation of lipolysis in adipocytes (hsa04923 )
Serotonergic synapse (hsa04726 )
Reactome Pathway
Synthesis of Prostaglandins (PG) and Thromboxanes (TX) (R-HSA-2162123 )
COX reactions (R-HSA-140180 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
30 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Candesartan DMRK8OT Chronic heart failure BD1Z Approved [66]
Dapsone DM4LT8A Acne vulgaris ED80 Approved [66]
Diazepam DM08E9O Alcohol withdrawal Approved [66]
Diphenhydramine DMKQTBA Hyperemesis gravidarum Approved [66]
Eicosapentaenoic acid/docosa-hexaenoic acid DMMUCG4 Hypertriglyceridemia 5C80.1 Approved [67]
Eletriptan DMW649X Migraine 8A80 Approved [66]
Etoposide DMNH3PG Acute myelogenous leukaemia 2A41 Approved [68]
Gamma-Homolinolenic acid DMSXKYG Malnutrition 5B50-5B71 Approved [67]
Gamolenic acid DMQN30Z Allergy 4A80-4A85 Approved [67]
Hexobarbital DMQ314B Anaesthesia 9A78.6 Approved [66]
Ifosfamide DMCT3I8 Adult central nervous system germ cell tumor Approved [66]
Imatinib DM7RJXL Acute lymphoblastic leukaemia 2A85 Approved [66]
Irbesartan DMTP1DC Diabetic kidney disease GB61.Z Approved [66]
Ketobemidone DMM3L6Z Pain MG30-MG3Z Approved [66]
Marinol DM70IK5 Anorexia nervosa cachexia 6B80 Approved [66]
Nateglinide DMLK2QH Diabetic complication 5A2Y Approved [66]
Nortriptyline DM4KDYJ Depression 6A70-6A7Z Approved [66]
Pioglitazone DMKJ485 Amyotrophic lateral sclerosis 8B60.0 Approved [66]
Rofecoxib DM3P5DA Osteoarthritis FA00-FA05 Approved [66]
Rosiglitazone DMILWZR Chronic kidney disease GB61 Approved [66]
Sulfamethoxazole DMB08GE Acute otitis media AB00 Approved [66]
Terbinafine DMI6HUW Fungal infection 1F29-1F2F Approved [66]
Thalidomide DM70BU5 Adult T-cell leukemia/lymphoma Approved [66]
Trabectedin DMG3Y89 Leiomyosarcoma 2B58 Approved [66]
Valproate DMCFE9I Epilepsy 8A60-8A68 Approved [66]
Voriconazole DMAOL2S Aspergillosis 1F20 Approved [66]
Zafirlukast DMHNQOG Asthma CA23 Approved [66]
Zileuton DMVRIC2 Allergic asthma CA23.0 Approved [66]
Zopiclone DMPI6Z0 Insomnia 7A00-7A0Z Approved [66]
Zaltoprofen DM9RJH7 N. A. N. A. Phase 4 [66]
⏷ Show the Full List of 30 Approved Drug(s)
1 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Seratrodast DMPNTDL Allergic asthma CA23.0 Discontinued in Phase 3 [66]
5 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
alpha-linolenic acid DMY64HE Discovery agent N.A. Investigative [67]
Arachidonic Acid DMUOQZD Discovery agent N.A. Investigative [69]
BML3-C01 DMER2WS N. A. N. A. Investigative [67]
Eicosadienoic acid DMVJK9W N. A. N. A. Investigative [67]
Icosapentum DMF1CM7 N. A. N. A. Investigative [67]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
alpha-linolenic acid Discovery agent [N.A.] Investigative Km = 0.0031 microM [67]
Arachidonic Acid Discovery agent [N.A.] Investigative Km = 0.0017 microM [67]
Eicosapentaenoic acid/docosa-hexaenoic acid Hypertriglyceridemia [5C80.1] Approved Km = 0.0011 microM [67]
Gamma-Homolinolenic acid Malnutrition [5B50-5B71] Approved Km = 0.002 microM [67]
Gamolenic acid Allergy [4A80-4A85] Approved Km = 0.0048 microM [67]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.43E-05 4.18E-01 6.74E-01
Alopecia ED70 Skin from scalp 5.55E-02 2.50E-01 4.84E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.97E-03 1.56E-01 4.33E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.13E-01 2.70E-01 5.97E-01
Aortic stenosis BB70 Calcified aortic valve 5.42E-01 4.22E-01 4.02E-01
Apnea 7A40 Hyperplastic tonsil 5.40E-01 7.90E-01 7.97E-01
Arthropathy FA00-FA5Z Peripheral blood 4.14E-02 3.87E-01 8.07E-01
Asthma CA23 Nasal and bronchial airway 5.11E-09 5.07E-01 9.56E-01
Atopic dermatitis EA80 Skin 4.11E-05 -3.71E-01 -1.66E+00
Autism 6A02 Whole blood 6.65E-02 2.29E-01 4.16E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.10E-01 3.78E-01 1.92E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.28E-01 2.30E-01 5.74E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.03E-03 -1.94E-01 -4.45E-01
Batten disease 5C56.1 Whole blood 6.89E-01 1.82E-01 2.17E-01
Behcet's disease 4A62 Peripheral blood 8.88E-01 -2.70E-02 -6.39E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.89E-01 -1.32E-01 -2.24E-01
Bladder cancer 2C94 Bladder tissue 7.05E-03 -1.89E+00 -1.28E+00
Breast cancer 2C60-2C6Z Breast tissue 9.97E-01 -9.62E-02 -1.94E-01
Cardioembolic stroke 8B11.20 Whole blood 3.86E-01 -2.04E-01 -4.61E-01
Cervical cancer 2C77 Cervical tissue 6.69E-03 -9.05E-01 -1.05E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.32E-02 5.08E-01 7.11E-01
Chronic hepatitis C 1E51.1 Whole blood 5.16E-01 6.87E-03 1.28E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 2.04E-01 -8.41E-02 -1.63E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.46E-05 2.14E-01 6.23E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.58E-01 9.51E-02 8.30E-01
Colon cancer 2B90 Colon tissue 1.24E-37 -8.46E-01 -1.61E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.88E-01 9.39E-01 1.19E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.45E-01 -6.62E-02 -9.47E-02
Endometriosis GA10 Endometrium tissue 2.17E-01 6.85E-01 4.32E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.39E-01 -3.44E-02 -1.13E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.71E-04 1.92E+00 2.05E+00
Gastric cancer 2B72 Gastric tissue 3.42E-01 -3.96E-01 -6.06E-01
Glioblastopma 2A00.00 Nervous tissue 1.72E-63 7.14E-01 1.48E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.54E-09 -1.15E+00 -2.94E+01
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.59E-01 -3.48E-01 -1.94E-01
Head and neck cancer 2D42 Head and neck tissue 6.06E-12 1.05E+00 7.98E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.53E-01 -1.03E-01 -6.11E-01
Huntington's disease 8A01.10 Whole blood 3.48E-01 4.02E-02 8.75E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.71E-02 7.25E-01 2.30E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.56E-02 6.56E-02 7.65E-01
Influenza 1E30 Whole blood 9.98E-02 -9.07E-01 -1.93E+00
Interstitial cystitis GC00.3 Bladder tissue 2.79E-01 1.05E+00 1.20E+00
Intracranial aneurysm 8B01.0 Intracranial artery 6.28E-05 1.18E+00 2.10E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.10E-01 -3.87E-02 -1.51E-01
Ischemic stroke 8B11 Peripheral blood 2.89E-01 1.83E-01 3.08E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.53E-09 4.11E-01 8.73E-01
Lateral sclerosis 8B60.4 Skin 2.46E-01 7.05E-01 9.44E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.19E-01 -1.40E-02 -9.21E-02
Liver cancer 2C12.0 Liver tissue 2.45E-08 -4.69E-01 -1.88E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.79E-03 1.24E+00 2.72E+00
Lung cancer 2C25 Lung tissue 2.29E-28 -5.62E-01 -1.35E+00
Lupus erythematosus 4A40 Whole blood 1.46E-05 4.28E-01 4.47E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.89E-01 9.78E-02 1.72E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.64E-02 2.18E-01 4.45E-01
Melanoma 2C30 Skin 2.96E-03 -1.12E+00 -9.55E-01
Multiple myeloma 2A83.1 Peripheral blood 3.72E-01 1.33E-01 7.30E-01
Multiple myeloma 2A83.1 Bone marrow 2.87E-02 -2.83E-01 -7.80E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.00E-02 1.81E-01 6.37E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.17E-02 1.24E-01 2.01E-01
Myelofibrosis 2A20.2 Whole blood 8.38E-01 -8.65E-02 -2.75E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.95E-04 1.79E+00 9.84E-01
Myopathy 8C70.6 Muscle tissue 3.14E-03 2.65E-01 1.10E+00
Neonatal sepsis KA60 Whole blood 1.95E-16 6.27E-01 1.29E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.17E-12 -1.26E+00 -5.98E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.71E-01 -6.56E-02 -3.30E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.16E-01 -2.08E-01 -5.93E-01
Olive pollen allergy CA08.00 Peripheral blood 7.93E-01 -1.56E-01 -2.98E-01
Oral cancer 2B6E Oral tissue 1.72E-06 8.99E-01 1.12E+00
Osteoarthritis FA00-FA0Z Synovial tissue 7.89E-01 2.37E-02 2.18E-02
Osteoporosis FB83.1 Bone marrow 9.61E-01 2.43E-01 2.96E-01
Ovarian cancer 2C73 Ovarian tissue 1.07E-03 3.59E+00 2.32E+00
Pancreatic cancer 2C10 Pancreas 1.81E-05 6.59E-01 1.75E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.19E-01 1.72E-01 5.16E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.40E-02 1.83E-01 2.94E-01
Pituitary cancer 2D12 Pituitary tissue 8.83E-01 -3.81E-01 -5.18E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.70E-02 -6.66E-01 -8.56E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.05E-02 8.15E-02 8.50E-01
Polycythemia vera 2A20.4 Whole blood 1.79E-06 3.88E-01 1.16E+00
Pompe disease 5C51.3 Biceps muscle 2.82E-01 -1.65E-01 -2.27E-01
Preterm birth KA21.4Z Myometrium 4.81E-01 -1.01E+00 -8.48E-01
Prostate cancer 2C82 Prostate 4.46E-01 -5.00E-02 -3.97E-02
Psoriasis EA90 Skin 7.86E-02 1.05E-01 2.02E-01
Rectal cancer 2B92 Rectal colon tissue 4.06E-03 -9.04E-01 -2.26E+00
Renal cancer 2C90-2C91 Kidney 2.36E-03 3.80E-01 6.29E-01
Retinoblastoma 2D02.2 Uvea 8.66E-04 6.83E-01 2.70E+00
Rheumatoid arthritis FA20 Synovial tissue 7.25E-01 -4.31E-02 -5.74E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.31E-02 4.23E-02 3.47E-01
Schizophrenia 6A20 Prefrontal cortex 3.26E-01 1.33E-01 1.12E-01
Schizophrenia 6A20 Superior temporal cortex 2.34E-01 4.46E-02 4.03E-01
Scleroderma 4A42.Z Whole blood 2.48E-01 1.88E-01 3.76E-01
Seizure 8A60-8A6Z Whole blood 2.73E-02 -3.80E-01 -6.89E-01
Sensitive skin EK0Z Skin 2.13E-02 2.40E-01 9.13E-01
Sepsis with septic shock 1G41 Whole blood 5.73E-12 2.65E-01 6.23E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.24E-02 -3.26E-01 -7.78E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.55E-03 4.44E-01 1.35E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.37E-01 1.03E-02 3.76E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.62E-02 4.69E-01 1.62E+00
Skin cancer 2C30-2C3Z Skin 2.54E-99 -2.57E+00 -4.16E+00
Thrombocythemia 3B63 Whole blood 1.94E-03 5.49E-01 1.74E+00
Thrombocytopenia 3B64 Whole blood 5.27E-02 8.16E-01 5.49E-01
Thyroid cancer 2D10 Thyroid 1.39E-12 4.87E-01 1.04E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.18E-07 6.15E-01 4.12E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.28E-02 1.04E+00 6.58E+00
Type 2 diabetes 5A11 Liver tissue 3.77E-01 3.23E-01 7.35E-01
Ureter cancer 2C92 Urothelium 5.77E-01 1.18E-02 8.93E-02
Uterine cancer 2C78 Endometrium tissue 2.10E-03 -3.85E-01 -2.74E-01
Vitiligo ED63.0 Skin 3.51E-02 1.75E-01 6.04E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Prostaglandin G/H synthase 1 (COX-1) DTT Info
DME DTT Type Successful
15 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Aminosalicylic Acid DMENSL5 Crohn disease DD70 Approved [1]
Balsalazide DM7I1T9 Inflammatory bowel disease DD72 Approved [2]
Bromfenac DMKB79O Pain MG30-MG3Z Approved [3]
Eicosapentaenoic acid/docosa-hexaenoic acid DMMUCG4 Hypertriglyceridemia 5C80.1 Approved [4]
FENBUFEN DMXGDFK Arthritis FA20 Approved [5]
Flufenamic Acid DMC8VNH Dysmenorrhea GA34.3 Approved [6]
Gamma-Homolinolenic acid DMSXKYG Malnutrition 5B50-5B71 Approved [7]
Meclofenamate Sodium DMNL98G Arthritis FA20 Approved [8]
Mesalazine DMOL5IU Diverticulitis Approved [9]
Naproxen DMZ5RGV Bursitis Approved [10]
Piroxicam DMTK234 Osteoarthritis FA00-FA05 Approved [1]
Salicyclic acid DM2F8XZ Acne vulgaris ED80 Approved [11]
Salsalate DM13P4C Osteoarthritis FA00-FA05 Approved [12]
Suprofen DMKXJZ7 Miosis LA11.62 Approved [13]
IMRECOXIB DMVXLOD N. A. N. A. Phase 4 [14]
⏷ Show the Full List of 15 Approved Drug(s)
6 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(S)-FLURBIPROFEN DMF2O4T Myalgia FB56.2 Preregistration [15]
Curcumin DMQPH29 Solid tumour/cancer 2A00-2F9Z Phase 3 [16]
Resveratrol DM3RWXL Giant cell arteritis 4A44.2 Phase 3 [17]
ThermoProfen DMPGH7N Pain MG30-MG3Z Phase 3 [18]
EPICATECHIN DMN0EMP Duchenne dystrophy 8C70 Phase 1/2 [19]
EXO-230 DM64PM7 Diabetic neuropathy 8C0Z Phase 1/2 [20]
⏷ Show the Full List of 6 Clinical Trial Drug(s)
1 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Carbamate derivative 2 DMEWPQ6 N. A. N. A. Patented [21]
8 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
INDOPROFEN DM5QSKN Gout FA25 Withdrawn from market [15]
Metamizole DM79GRO Fever MG26 Withdrawn from market [22]
Phenacetin DMRQAM0 Analgesia MB40.8 Withdrawn from market [23]
CRx-401 DM39N7W Type-2 diabetes 5A11 Discontinued in Phase 2 [24]
R-ketoprofen DMHSUQ1 N. A. N. A. Discontinued in Phase 2 [15]
TEBUFELONE DMMUE8P Pain MG30-MG3Z Discontinued in Phase 2 [25]
ATLIPROFEN METHYL ESTER DMS2FB3 Inflammation 1A00-CA43.1 Terminated [1]
SC-58451 DMVGK24 N. A. N. A. Terminated [26]
⏷ Show the Full List of 8 Discontinued Drug(s)
106 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(-)-3-O-acetylspectaline DMKRTBM Discovery agent N.A. Investigative [27]
(11H-Dibenzo[b,e][1,4]dioxepin-2-yl)-acetic acid DMSUPVE Discovery agent N.A. Investigative [28]
(11H-Dibenzo[b,e][1,4]dioxepin-7-yl)-acetic acid DM5ZTXL Discovery agent N.A. Investigative [28]
(11H-Dibenzo[b,e][1,4]dioxepin-8-yl)-acetic acid DMBY623 Discovery agent N.A. Investigative [28]
(3-Chloro-4-Propoxy-Phenyl)-Acetic Acid DMHODXG Discovery agent N.A. Investigative [29]
(R)-2-(4-Isobutyl-phenyl)-N-phenyl-propionamide DMAD4JY Discovery agent N.A. Investigative [15]
(Z)-2'-des-methyl sulindac sulfide DM0OEQJ Discovery agent N.A. Investigative [30]
1,2-dihydro-3-(2,3,4-trimethoxyphenyl)naphthalene DMST60D Discovery agent N.A. Investigative [31]
1-(4-(methylsulfonyl)phenyl)-3-p-tolylurea DMMSQLC Discovery agent N.A. Investigative [32]
1-(4-(methylsulfonyl)phenyl)-3-phenylurea DMH7RY0 Discovery agent N.A. Investigative [32]
1-(4-aminosulfonylphenyl)-2-(2-pyridyl)acetylene DMWA6G1 Discovery agent N.A. Investigative [33]
1-(4-aminosulfonylphenyl)-2-(4-pyridyl)acetylene DMP93E2 Discovery agent N.A. Investigative [33]
2'-epi-guianin DMNVJY0 Discovery agent N.A. Investigative [34]
2,4'-Dimethoxy-5,3'-di-(2-propenyl)-biphenyl DMWNJ84 Discovery agent N.A. Investigative [35]
2-(1,1'-Biphenyl-4-Yl)Propanoic Acid DMUE0D6 Discovery agent N.A. Investigative [29]
2-(2,3,4-trimethoxyphenyl)-1H-indene DMFU1PK Discovery agent N.A. Investigative [31]
2-(2-(2,6-dimethylphenylamino)phenyl)acetic acid DMJ2DE4 Discovery agent N.A. Investigative [36]
2-(2-methoxyphenyl)-1H-indene DMXFYN8 Discovery agent N.A. Investigative [31]
2-(2-Methylpropanoyl)-1,3,5-benzenetriol DMPH63G Discovery agent N.A. Investigative [37]
2-(3'-Allyl-biphenyl-4-yl)-propionic acid DMAGFUH Discovery agent N.A. Investigative [38]
2-(3'-Ethyl-biphenyl-4-yl)-propionic acid DMPLN58 Discovery agent N.A. Investigative [38]
2-(3'-Ethylsulfanyl-biphenyl-4-yl)-propionic acid DMPGYDA Discovery agent N.A. Investigative [38]
2-(3'-Vinyl-biphenyl-4-yl)-propionic acid DM7NGV1 Discovery agent N.A. Investigative [38]
2-(3-Phenyl-propyl)-1,2-dihydro-indazol-3-one DMIQBXD Discovery agent N.A. Investigative [39]
2-(N-(2-Ffuorophenyl)pyrrol-3-yl) acetic acid DMRNOM6 Discovery agent N.A. Investigative [40]
2-(N-(2-fluorophenyl)pyrrol-2-yl) acetic acid DMCL9E6 Discovery agent N.A. Investigative [40]
2-(p-Methylsulfonylbenzoyl)furan DMLT635 Discovery agent N.A. Investigative [41]
2-Benzyl-1,2-dihydro-indazol-3-one DM1CB5J Discovery agent N.A. Investigative [39]
2-Bromoacetyl Group DMIHJSA Discovery agent N.A. Investigative [42]
2-Furan-2-ylmethyl-1,2-dihydro-indazol-3-one DMQIRY7 Discovery agent N.A. Investigative [39]
2-Methyl-1,2-dihydro-indazol-3-one DMDJHFQ Discovery agent N.A. Investigative [39]
2-Naphthalen-2-ylmethyl-1,2-dihydro-indazol-3-one DM1EJ6W Discovery agent N.A. Investigative [39]
2-Phenethyl-1,2-dihydro-indazol-3-one DM0WMBC Discovery agent N.A. Investigative [39]
2-Phenyl-1,2-dihydro-indazol-3-one DM28CLZ Discovery agent N.A. Investigative [39]
2-[4-(1H-Indol-5-yl)-phenyl]-propionic acid DMUHECR Discovery agent N.A. Investigative [38]
3 beta-O-acetyloleanolic acid DM1L5IJ Discovery agent N.A. Investigative [43]
3-(4-Methanesulfonyl-phenyl)-1-phenyl-propynone DMSR2O3 Discovery agent N.A. Investigative [44]
4'-Methoxy-5,3'-dipropyl-biphenyl-2ol DM5FRV2 Discovery agent N.A. Investigative [35]
4,5-Bis(4-chlorophenyl)-1,2-selenazole DMIO254 Discovery agent N.A. Investigative [45]
4,5-Bis(4-chlorophenyl)isothiazole DMENLFY Discovery agent N.A. Investigative [46]
4,5-Bis(4-methoxyphenyl)-1,2-selenazole DMKHD1M Discovery agent N.A. Investigative [45]
4,5-Bis(4-methoxyphenyl)-3H-1,2-dithiol-3-one DMI39QT Discovery agent N.A. Investigative [46]
4,5-Bis(4-methoxyphenyl)-3H-1,2-dithiole-3-thione DMPW145 Discovery agent N.A. Investigative [46]
4,5-Bis(4-methoxyphenyl)isothiazole DM90DV6 Discovery agent N.A. Investigative [46]
4-(4-Chlorophenyl)-5-(4-methoxyphenyl)isothiazole DMODVGN Discovery agent N.A. Investigative [46]
4-(4-Chlorophenyl)-5-p-tolyl-1,2-selenazole DMZBEYO Discovery agent N.A. Investigative [45]
4-(4-Chlorophenyl)-5-p-tolyl-3H-1,2-dithiol-3-one DMVDF9Q Discovery agent N.A. Investigative [46]
4-(4-Chlorophenyl)-5-p-tolylisothiazole DMMK9RC Discovery agent N.A. Investigative [46]
4-(5-(4-Hydroxyphenyl)isothiazol-4-yl)phenol DMK1ZF2 Discovery agent N.A. Investigative [46]
4-amino-N-(2-chlorophenyl)benzenesulfonamide DM6PQ5V Discovery agent N.A. Investigative [47]
4-amino-N-(4-chlorophenyl)benzenesulfonamide DMCUSD4 Discovery agent N.A. Investigative [47]
4-amino-N-p-tolylbenzenesulfonamide DMLW651 Discovery agent N.A. Investigative [47]
5,3'-Dipropyl-biphenyl-2,4'-diol DMJRXLD Discovery agent N.A. Investigative [35]
5-(2-1H-indenyl)-1,3-benzodioxole DM149IX Discovery agent N.A. Investigative [31]
5-(2-Imidazol-1-yl-ethyl)-7,8-dihydro-quinoline DMCP5U8 Discovery agent N.A. Investigative [48]
5-(4-Chlorophenyl)-4-(4-methoxyphenyl)isothiazole DMSTG03 Discovery agent N.A. Investigative [46]
5-(4-Chlorophenyl)-4-p-tolyl-1,2-selenazole DMY0P86 Discovery agent N.A. Investigative [45]
5-(4-Chlorophenyl)-4-p-tolyl-3H-1,2-dithiol-3-one DMFYEL8 Discovery agent N.A. Investigative [46]
5-(4-Chlorophenyl)-4-p-tolylisothiazole DMA1N75 Discovery agent N.A. Investigative [46]
5-(4-Methoxyphenyl)-4-p-tolyl-1,2-selenazole DMEV8WS Discovery agent N.A. Investigative [45]
5-(4-Methoxyphenyl)-4-p-tolylisothiazole DMJSTCK Discovery agent N.A. Investigative [46]
5-Ethyl-3,4-diphenyl-isoxazole DMRIGXA Discovery agent N.A. Investigative [49]
5-Methyl-3,4-diphenyl-isoxazole DM0G2N5 Discovery agent N.A. Investigative [49]
5-Phenyl-pentanoic acid benzyl-hydroxy-amide DM3B6A8 Discovery agent N.A. Investigative [50]
Acetic acid 2-hept-2-ynylsulfanyl-phenyl ester DM97DJL Discovery agent N.A. Investigative [51]
Acetic acid 2-hept-3-ynylsulfanyl-phenyl ester DMD89A1 Discovery agent N.A. Investigative [51]
Acetic acid 2-heptylselanyl-phenyl ester DM50BTA Discovery agent N.A. Investigative [51]
Acetic acid 2-heptylsulfanyl-phenyl ester DMLPRIG Discovery agent N.A. Investigative [51]
Acetic acid 2-hex-2-ynylsulfanyl-phenyl ester DMFQE1C Discovery agent N.A. Investigative [51]
Acetic acid 2-hexylsulfanyl-phenyl ester DMAKNUH Discovery agent N.A. Investigative [51]
Acetic acid 2-pentylsulfanyl-phenyl ester DMFKRIH Discovery agent N.A. Investigative [51]
Acetic Acid Salicyloyl-Amino-Ester DMLTNHY Discovery agent N.A. Investigative [29]
Alpha-D-Mannose DMF5DLW Discovery agent N.A. Investigative [42]
Arachidonic Acid DMUOQZD Discovery agent N.A. Investigative [42]
B-Octylglucoside DMMO75G Discovery agent N.A. Investigative [42]
Beta-D-Glucose DM5IHYP Discovery agent N.A. Investigative [42]
Beta-D-Mannose DMHIG9K Discovery agent N.A. Investigative [42]
CATECHIN DMY38SB Discovery agent N.A. Investigative [19]
DEMETHOXYCURCUMIN DMO5UGV Discovery agent N.A. Investigative [16]
FR122047 DMAYTWN Discovery agent N.A. Investigative [52]
Heme DMGC287 Discovery agent N.A. Investigative [29]
HONOKIOL DMJWT3X Discovery agent N.A. Investigative [35]
Hyperforin DM2L3PE Discovery agent N.A. Investigative [53]
IODOINDOMETHACIN DM3BL0G Discovery agent N.A. Investigative [54]
IODOSUPROFEN DMOE8LT Discovery agent N.A. Investigative [54]
METHYLHONOKIOL DM9YE6K Discovery agent N.A. Investigative [35]
N-(1H-indazol-5-yl)acetamide DMIMJNU Discovery agent N.A. Investigative [55]
N-(3-(phenylthio)pyridin-4-yl)methanesulfonamide DMSJX1H Discovery agent N.A. Investigative [56]
N-(3-phenoxy-4-pyridinyl)ethanesulfonamide DMXF46V Discovery agent N.A. Investigative [57]
N-(3-phenoxy-4-pyridinyl)propanesulfonamide DMN1DPJ Discovery agent N.A. Investigative [57]
N-(3-phenoxypyridin-4-yl)methanesulfonamide DM7CM3F Discovery agent N.A. Investigative [56]
N-(3-phenylamino-4-pyridinyl)methanesulfonamide DMJB7SE Discovery agent N.A. Investigative [56]
Nitroflurbiprofen DMWCV48 Discovery agent N.A. Investigative [58]
O-Acetylserine DMAEHFT Discovery agent N.A. Investigative [42]
Oxametacin DMWVLG1 Discovery agent N.A. Investigative [59]
P-(2'-Iodo-5'-Thenoyl)Hydrotropic Acid DMJ0W43 Discovery agent N.A. Investigative [29]
Phenazone DMCE985 Discovery agent N.A. Investigative [60]
PHENIDONE DMJD8XN Discovery agent N.A. Investigative [39]
Prifelone DMLI4RF Discovery agent N.A. Investigative [61]
Primary alcohol metabolite of celecoxib DMA8GI6 Discovery agent N.A. Investigative [62]
Protoporphyrin Ix Containing Co DMJ8TP3 Discovery agent N.A. Investigative [42]
RESORCINOL DMM37C0 Discovery agent N.A. Investigative [19]
Resveratrol Potassium3-Sulfate DMN1RLA Discovery agent N.A. Investigative [63]
Resveratrol Potassium4,-Sulfate DMMFP57 Discovery agent N.A. Investigative [63]
SC-560 DMT1GJL Discovery agent N.A. Investigative [64]
TRL-382 DMU3E1M Neuropathic pain 8E43.0 Investigative [65]
⏷ Show the Full List of 106 Investigative Drug(s)

References

1 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
2 Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34.
3 Comparison of cyclooxygenase inhibitory activity and ocular anti-inflammatory effects of ketorolac tromethamine and bromfenac sodium. Curr Med Res Opin. 2006 Jun;22(6):1133-40.
4 Cox-2 inhibitory effects of naturally occurring and modified fatty acids. J Nat Prod. 2001 Jun;64(6):745-9.
5 Fenbufen based 3-[5-(substituted aryl)-1,3,4-oxadiazol-2-yl]-1-(biphenyl-4-yl)propan-1-ones as safer antiinflammatory and analgesic agents. Eur J Med Chem. 2009 Sep;44(9):3798-804.
6 Ouellet M, Percival MD: Effect of inhibitor time-dependency on selectivity towards cyclooxygenase isoforms. Biochem J. 1995 Feb 15;306 ( Pt 1):247-51.
7 Differential metabolism of dihomo-gamma-linolenic acid and arachidonic acid by cyclo-oxygenase-1 and cyclo-oxygenase-2: implications for cellular synthesis of prostaglandin E1 and prostaglandin E2. Biochem J. 2002 Jul 15;365(Pt 2):489-96.
8 Role of COX-2-derived metabolites in regulation of the renal hemodynamic response to norepinephrine. Am J Physiol Renal Physiol. 2001 Nov;281(5):F975-82.
9 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
10 Comparative inhibitory activity of rofecoxib, meloxicam, diclofenac, ibuprofen, and naproxen on COX-2 versus COX-1 in healthy volunteers. J Clin Pharmacol. 2000 Oct;40(10):1109-20.
11 The C50T polymorphism of the cyclooxygenase-1 gene and the risk of thrombotic events during low-dose therapy with acetyl salicylic acid. Thromb Haemost. 2008 Jul;100(1):70-5.
12 New non-steroidal anti-rheumatic drugs: selective inhibitors of inducible cyclooxygenase. Med Klin (Munich). 1998 Jul 15;93(7):407-15.
13 Differential binding mode of diverse cyclooxygenase inhibitors. J Mol Graph Model. 2002 Mar;20(5):359-71.
14 Synthesis and anti-inflammatory activity of the major metabolites of imrecoxib. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2270-2.
15 2-Arylpropionic CXC chemokine receptor 1 (CXCR1) ligands as novel noncompetitive CXCL8 inhibitors. J Med Chem. 2005 Jun 30;48(13):4312-31.
16 Design, synthesis, biological evaluation and molecular docking of curcumin analogues as antioxidant, cyclooxygenase inhibitory and anti-inflammator... Bioorg Med Chem Lett. 2005 Apr 1;15(7):1793-7.
17 Resveratrol is a peroxidase-mediated inactivator of COX-1 but not COX-2: a mechanistic approach to the design of COX-1 selective agents. J Biol Chem. 2004 May 21;279(21):22727-37.
18 Topical NSAID therapy for musculoskeletal pain. Pain Med. 2010 Apr;11(4):535-49.
19 Mechanism-based inactivation of COX-1 by red wine m-hydroquinones: a structure-activity relationship study. J Nat Prod. 2004 Nov;67(11):1777-82.
20 Inhibiting Amadori-modified albumin formation improves biomarkers of podocyte damage in diabetic rats. Physiol Rep. 2013 September; 1(4): e00083.
21 Fatty acid amide hydrolase inhibitors: a patent review (2009-2014).Expert Opin Ther Pat. 2015;25(11):1247-66.
22 Mechanisms of action of paracetamol and related analgesics. Inflammopharmacology. 2003;11(4):401-13.
23 Direct toxicity of nonsteroidal antiinflammatory drugs for renal medullary cells. Proc Natl Acad Sci U S A. 2001 Apr 24;98(9):5317-22.
24 ClinicalTrials.gov (NCT00506298) Study of CRx-401 on Glucose Levels in Subjects With Type II Diabetes. U.S. National Institutes of Health.
25 New cyclooxygenase-2/5-lipoxygenase inhibitors. 2. 7-tert-butyl-2,3-dihydro-3,3-dimethylbenzofuran derivatives as gastrointestinal safe antiinflamm... J Med Chem. 1998 Mar 26;41(7):1124-37.
26 Novel 1,2-diarylcyclobutenes: Selective and orally active cox-2 inhibitors, Bioorg. Med. Chem. Lett. 6(22):2677-2682 (1996).
27 Lipoperoxidation and cyclooxygenase enzyme inhibitory piperidine alkaloids from Cassia spectabilis green fruits. J Nat Prod. 2007 Dec;70(12):2026-8.
28 Synthesis and antiinflammatory/analgesic activities of 11H-dibenzo[b, e,][1,4]dioxepinacetic acids. J Med Chem. 1986 Aug;29(8):1436-41.
29 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
30 The influence of double bond geometry in the inhibition of cyclooxygenases by sulindac derivatives. Bioorg Med Chem Lett. 2009 Jun 15;19(12):3271-4.
31 'Bridged' stilbene derivatives as selective cyclooxygenase-1 inhibitors. Bioorg Med Chem. 2007 Sep 15;15(18):6109-18.
32 Design and synthesis of 1,3-diarylurea derivatives as selective cyclooxygenase (COX-2) inhibitors. Bioorg Med Chem Lett. 2008 Feb 15;18(4):1336-9.
33 Synthesis and cyclooxygenase inhibitory activities of linear 1-(methanesulfonylphenyl or benzenesulfonamido)-2-(pyridyl)acetylene regioisomers. Bioorg Med Chem. 2008 Feb 15;16(4):1948-56.
34 COX, LOX and platelet aggregation inhibitory properties of Lauraceae neolignans. Bioorg Med Chem Lett. 2009 Dec 15;19(24):6922-5.
35 Design and synthesis of ten biphenyl-neolignan derivatives and their in vitro inhibitory potency against cyclooxygenase-1/2 activity and 5-lipoxyge... Bioorg Med Chem. 2009 Jul 1;17(13):4459-65.
36 Molecular determinants for the selective inhibition of cyclooxygenase-2 by lumiracoxib. J Biol Chem. 2007 Jun 1;282(22):16379-90.
37 Anti-inflammatory acylphloroglucinol derivatives from Hops (Humulus lupulus). J Nat Prod. 2005 Oct;68(10):1545-8.
38 Structure-based design of COX-2 selectivity into flurbiprofen. Bioorg Med Chem Lett. 1999 Feb 8;9(3):307-12.
39 Indazolinones, a new series of redox-active 5-lipoxygenase inhibitors with built-in selectivity and oral activity. J Med Chem. 1991 Mar;34(3):1028-36.
40 Synthesis and biological activity of new anti-inflammatory compounds containing the 1,4-benzodioxine and/or pyrrole system. Bioorg Med Chem. 2007 Jul 15;15(14):4876-90.
41 Synthesis, anti-inflammatory activity, and in vitro antitumor effect of a novel class of cyclooxygenase inhibitors: 4-(aryloyl)phenyl methyl sulfones. J Med Chem. 2010 Sep 23;53(18):6560-71.
42 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
43 Nitrogen-containing phorbol esters from Croton ciliatoglandulifer and their effects on cyclooxygenases-1 and -2. J Nat Prod. 2006 Jun;69(6):887-90.
44 Synthesis and biological evaluation of 1,3-diphenylprop-2-yn-1-ones as dual inhibitors of cyclooxygenases and lipoxygenases. Bioorg Med Chem Lett. 2005 Nov 1;15(21):4842-5.
45 Investigations concerning the COX/5-LOX inhibiting and hydroxyl radical scavenging potencies of novel 4,5-diaryl isoselenazoles. Eur J Med Chem. 2008 Jun;43(6):1152-9.
46 Diaryl-dithiolanes and -isothiazoles: COX-1/COX-2 and 5-LOX-inhibitory, *OH scavenging and anti-adhesive activities. Bioorg Med Chem. 2009 Jan 15;17(2):558-68.
47 Analgesic agents without gastric damage: design and synthesis of structurally simple benzenesulfonanilide-type cyclooxygenase-1-selective inhibitors. Bioorg Med Chem. 2007 Jan 15;15(2):1014-21.
48 1-imidazolyl(alkyl)-substituted di- and tetrahydroquinolines and analogues: syntheses and evaluation of dual inhibitors of thromboxane A(2) synthas... J Med Chem. 2000 May 4;43(9):1841-51.
49 Novel synthesis of 3,4-diarylisoxazole analogues of valdecoxib: reversal cyclooxygenase-2 selectivity by sulfonamide group removal. J Med Chem. 2004 Sep 23;47(20):4881-90.
50 Differential effects of a series of hydroxamic acid derivatives on 5-lipoxygenase and cyclooxygenase from neutrophils and 12-lipoxygenase from plat... J Med Chem. 1989 Aug;32(8):1836-42.
51 Covalent modification of cyclooxygenase-2 (COX-2) by 2-acetoxyphenyl alkyl sulfides, a new class of selective COX-2 inactivators. J Med Chem. 1998 Nov 19;41(24):4800-18.
52 The analgesic effect profile of FR122047, a selective cyclooxygenase-1 inhibitor, in chemical nociceptive models. Eur J Pharmacol. 2000 Mar 10;391(1-2):49-54.
53 Hyperforin is a dual inhibitor of cyclooxygenase-1 and 5-lipoxygenase. Biochem Pharmacol. 2002 Dec 15;64(12):1767-75.
54 In silico search for multi-target anti-inflammatories in Chinese herbs and formulas. Bioorg Med Chem. 2010 Mar 15;18(6):2204-2218.
55 New analgesics synthetically derived from the paracetamol metabolite N-(4-hydroxyphenyl)-(5Z,8Z,11Z,14Z)-icosatetra-5,8,11,14-enamide. J Med Chem. 2008 Dec 25;51(24):7800-5.
56 Pyridine analogues of nimesulide: design, synthesis, and in vitro and in vivo pharmacological evaluation as promising cyclooxygenase 1 and 2 inhibi... J Med Chem. 2009 Oct 8;52(19):5864-71.
57 Design, synthesis, and pharmacological evaluation of pyridinic analogues of nimesulide as cyclooxygenase-2 selective inhibitors. J Med Chem. 2004 Dec 30;47(27):6749-59.
58 The cyclooxygenase inhibitor flurbiprofen reduces radiation-induced angiogenic growth factor secretion of squamous cell carcinoma cell lines. Ann N Y Acad Sci. 2004 Dec;1030:37-42.
59 Structure-based design, synthesis, and biological evaluation of indomethacin derivatives as cyclooxygenase-2 inhibiting nitric oxide donors. J Med Chem. 2007 Dec 13;50(25):6367-82.
60 Pharmacokinetic and pharmacodynamic aspects of the ideal COX-2 inhibitor: a pharmacologist's perspective. Clin Exp Rheumatol. 2001 Nov-Dec;19(6 Suppl 25):S51-7.
61 Designed multiple ligands. An emerging drug discovery paradigm. J Med Chem. 2005 Oct 20;48(21):6523-43.
62 Diazen-1-ium-1,2-diolated nitric oxide donor ester prodrugs of 5-(4-hydroxymethylphenyl)-1-(4-aminosulfonylphenyl)-3-trifluoromethyl-1H-pyrazole an... Bioorg Med Chem. 2008 Nov 15;16(22):9694-8.
63 Selective synthesis and biological evaluation of sulfate-conjugated resveratrol metabolites. J Med Chem. 2010 Jul 8;53(13):5033-43.
64 Synthesis and antiinflammatory activity of coumarin derivatives. J Med Chem. 2005 Oct 6;48(20):6400-8.
65 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1375).
66 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
67 Divergent cyclooxygenase responses to fatty acid structure and peroxide level in fish and mammalian prostaglandin H synthases. FASEB J. 2006 Jun;20(8):1097-108.
68 Peroxidative free radical formation and O-demethylation of etoposide(VP-16) and teniposide(VM-26). Biochem Biophys Res Commun. 1986 Feb 26;135(1):215-20.
69 Identification and functional characterization of polymorphisms in human cyclooxygenase-1 (PTGS1). Pharmacogenet Genomics. 2007 Feb;17(2):145-60.