Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5C404P)

• DOT Name: E3 ubiquitin-protein ligase MIB1 (MIB1)
• Synonyms: EC 2.3.2.27; DAPK-interacting protein 1; DIP-1; Mind bomb homolog 1; RING-type E3 ubiquitin transferase MIB1; Zinc finger ZZ type with ankyrin repeat domain protein 2
• Gene Name: MIB1
• Related Disease:
  Behcet disease
  Bladder cancer
  Ependymoma
  Adenoma
  Adult glioblastoma
  Autism spectrum disorder
  B-cell lymphoma
  Brain neoplasm
  Breast cancer
  Breast carcinoma
  Cervical Intraepithelial neoplasia
  Chromosomal disorder
  Classic Hodgkin lymphoma
  Clear cell renal carcinoma
  Colorectal neoplasm
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Familial adenomatous polyposis
  Glioblastoma multiforme
  Glioma
  Hemangioblastoma
  Meningioma
  Metastatic malignant neoplasm
  Neuroendocrine neoplasm
  Non-hodgkin lymphoma
  Ovarian cancer
  Psoriasis
  Renal cell carcinoma
  Retinoblastoma
  Rhabdomyosarcoma
  Rheumatoid arthritis
  Small lymphocytic lymphoma
  Transitional cell carcinoma
  Urinary bladder neoplasm
  Urothelial carcinoma
  Wilms tumor
  Colorectal carcinoma
  Prostate cancer
  Prostate carcinoma
  Left ventricular noncompaction
  Adenocarcinoma
  B-cell neoplasm
  Follicular lymphoma
  Left ventricular noncompaction 7
  Plasma cell myeloma
  Urinary bladder cancer
  Dilated cardiomyopathy
  Isolated cleft palate
• UniProt ID: MIB1_HUMAN
• PDB ID: 4TSE; 4XI6; 4XI7; 4XIB
• EC Number: 2.3.2.27
• Pfam ID: PF12796 ; PF13637 ; PF06701 ; PF18346 ; PF13920 ; PF00569
• Sequence:
  MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANY
  RCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHL
  RHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTE
  IQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGN
  RNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPS
  GNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAE
  AMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLLK
  KLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDIL
  KLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNK
  GHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNAL
  HHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLD
  IQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQD
  MQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLC
  PDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATC
  SLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQC
  RAVVERRVPFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQ
  TMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY
• Function: E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. Probably mediates ubiquitination and subsequent proteasomal degradation of DAPK1, thereby antagonizing anti-apoptotic effects of DAPK1 to promote TNF-induced apoptosis. Involved in ubiquitination of centriolar satellite CEP131, CEP290 and PCM1 proteins and hence inhibits primary cilium formation in proliferating cells. Mediates 'Lys-63'-linked polyubiquitination of TBK1, which probably participates in kinase activation; (Microbial infection) During adenovirus infection, mediates ubiquitination of Core-capsid bridging protein. This allows viral genome delivery into nucleus for infection.
• Tissue Specificity: Widely expressed at low level. Expressed at higher level in spinal cord, ovary, whole brain, and all specific brain regions examined.
• KEGG Pathway: Lipid and atherosclerosis (hsa05417)
• Reactome Pathway:
  Constitutive Signaling by NOTCH1 PEST Domain Mutants (R-HSA-2644606)
  Constitutive Signaling by NOTCH1 HD Domain Mutants (R-HSA-2691232)
  Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants (R-HSA-2894862)
  NOTCH2 Activation and Transmission of Signal to the Nucleus (R-HSA-2979096)
  NOTCH3 Activation and Transmission of Signal to the Nucleus (R-HSA-9013507)
  Activated NOTCH1 Transmits Signal to the Nucleus (R-HSA-2122948)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Behcet disease	DISSYMBS	Definitive	Genetic Variation	[1]
Bladder cancer	DISUHNM0	Definitive	Altered Expression	[2]
Ependymoma	DISUMRNZ	Definitive	Altered Expression	[3]
Adenoma	DIS78ZEV	Strong	Biomarker	[4]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[5]
Autism spectrum disorder	DISXK8NV	Strong	Genetic Variation	[6]
B-cell lymphoma	DISIH1YQ	Strong	Biomarker	[7]
Brain neoplasm	DISY3EKS	Strong	Altered Expression	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Cervical Intraepithelial neoplasia	DISXP757	Strong	Biomarker	[10]
Chromosomal disorder	DISM5BB5	Strong	Biomarker	[11]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[12]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[13]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[14]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[15]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[16]
Familial adenomatous polyposis	DISW53RE	Strong	Biomarker	[4]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[5]
Glioma	DIS5RPEH	Strong	Genetic Variation	[17]
Hemangioblastoma	DIS1EAZC	Strong	Biomarker	[18]
Meningioma	DISPT4TG	Strong	Altered Expression	[19]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[20]
Neuroendocrine neoplasm	DISNPLOO	Strong	Biomarker	[21]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Biomarker	[22]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[15]
Psoriasis	DIS59VMN	Strong	Biomarker	[23]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[13]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[24]
Rhabdomyosarcoma	DISNR7MS	Strong	Biomarker	[25]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[26]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[27]
Transitional cell carcinoma	DISWVVDR	Strong	Biomarker	[28]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[2]
Urothelial carcinoma	DISRTNTN	Strong	Biomarker	[28]
Wilms tumor	DISB6T16	Strong	Altered Expression	[29]
Colorectal carcinoma	DIS5PYL0	moderate	Biomarker	[30]
Prostate cancer	DISF190Y	moderate	Altered Expression	[31]
Prostate carcinoma	DISMJPLE	moderate	Altered Expression	[31]
Left ventricular noncompaction	DISJ4QEG	Supportive	Autosomal dominant	[32]
Adenocarcinoma	DIS3IHTY	Limited	Biomarker	[33]
B-cell neoplasm	DISVY326	Limited	Genetic Variation	[34]
Follicular lymphoma	DISVEUR6	Limited	Genetic Variation	[34]
Left ventricular noncompaction 7	DISWIOC6	Limited	Unknown	[32]
Plasma cell myeloma	DIS0DFZ0	Limited	Altered Expression	[35]
Urinary bladder cancer	DISDV4T7	Limited	Biomarker	[36]
Dilated cardiomyopathy	DISX608J	No Known	Autosomal dominant	[37]
Isolated cleft palate	DISV80CD	No Known	Unknown	[38]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of E3 ubiquitin-protein ligase MIB1 (MIB1).	[39]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of E3 ubiquitin-protein ligase MIB1 (MIB1).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of E3 ubiquitin-protein ligase MIB1 (MIB1).	[41]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of E3 ubiquitin-protein ligase MIB1 (MIB1).	[42]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of E3 ubiquitin-protein ligase MIB1 (MIB1).	[43]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of E3 ubiquitin-protein ligase MIB1 (MIB1).	[44]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of E3 ubiquitin-protein ligase MIB1 (MIB1).	[45]
Marinol	DM70IK5	Approved	Marinol increases the expression of E3 ubiquitin-protein ligase MIB1 (MIB1).	[46]
Enzalutamide	DMGL19D	Approved	Enzalutamide affects the expression of E3 ubiquitin-protein ligase MIB1 (MIB1).	[47]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of E3 ubiquitin-protein ligase MIB1 (MIB1).	[48]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of E3 ubiquitin-protein ligase MIB1 (MIB1).	[49]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of E3 ubiquitin-protein ligase MIB1 (MIB1).	[50]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride decreases the expression of E3 ubiquitin-protein ligase MIB1 (MIB1).	[51]
Sanggenon C	DMSF5DW	Investigative	Sanggenon C decreases the expression of E3 ubiquitin-protein ligase MIB1 (MIB1).	[52]

References

• [1] Analysis of microsatellite polymorphism around the HLA-B locus in Iranian patients with Behet's disease.Tissue Antigens. 2002 Nov;60(5):396-9. doi: 10.1034/j.1399-0039.2002.600506.x.
• [2] Molecular grade (FGFR3/MIB-1) and EORTC risk scores are predictive in primary non-muscle-invasive bladder cancer.Eur Urol. 2010 Sep;58(3):433-41. doi: 10.1016/j.eururo.2010.05.043. Epub 2010 Jun 9.
• [3] Expression and Clinical Significance of Translation Regulatory Long Non-Coding RNA 1 (TRERNA1) in Ependymomas.Pathol Oncol Res. 2020 Jul;26(3):1975-1981. doi: 10.1007/s12253-019-00736-8. Epub 2019 Sep 5.
• [4] Parafibromin, APC, and MIB-1 Are Useful Markers for Distinguishing Parathyroid Carcinomas From Adenomas.Appl Immunohistochem Mol Morphol. 2017 Nov/Dec;25(10):731-735. doi: 10.1097/PAI.0000000000000378.
• [5] Multicentric Glioma Develops via a Mutant IDH1-Independent Pathway: Immunohistochemical Study of Multicentric Glioma.Pathobiology. 2017;84(2):99-107. doi: 10.1159/000447951. Epub 2016 Aug 24.
• [6] HLA polymorphisms in Italian children with autism spectrum disorders: results of a family based linkage study.J Neuroimmunol. 2011 Jan;230(1-2):135-42. doi: 10.1016/j.jneuroim.2010.10.019. Epub 2010 Nov 17.
• [7] Primary thyroid lymphoma: A series from a tertiary care center in Northern India.J Cancer Res Ther. 2019 Jul-Sep;15(3):669-675. doi: 10.4103/jcrt.JCRT_135_17.
• [8] Transcriptional expression of survivin and its splice variants in brain tumors in humans.J Neurosurg. 2003 Oct;99(4):738-45. doi: 10.3171/jns.2003.99.4.0738.
• [9] Prognostic implication of p53 protein expression in relation to nuclear pleomorphism and the MIB-1 counts in breast cancer.Breast Cancer. 2004;11(2):160-8. doi: 10.1007/BF02968296.
• [10] Evaluation of MIB-1-positive cell clusters as a diagnostic marker for cervical intraepithelial neoplasia.Am J Surg Pathol. 2002 Nov;26(11):1501-7. doi: 10.1097/00000478-200211000-00013.
• [11] Biologic tumor behavior in pilocytic astrocytomas.Childs Nerv Syst. 2012 Mar;28(3):375-89. doi: 10.1007/s00381-011-1676-6. Epub 2012 Jan 14.
• [12] Apoptosis and cell cycle-related genes and proteins in classical Hodgkin lymphoma: application of tissue microarray technique.Appl Immunohistochem Mol Morphol. 2003 Sep;11(3):206-13. doi: 10.1097/00129039-200309000-00002.
• [13] Prognostic and clinicopathological value of Ki-67/MIB-1 expression in renal cell carcinoma: a meta-analysis based on 4579 individuals.Cancer Manag Res. 2017 Nov 21;9:679-689. doi: 10.2147/CMAR.S141670. eCollection 2017.
• [14] Effects of vitamin D and calcium on expression of MSH2 and transforming growth factors in normal-appearing colorectal mucosa of sporadic colorectal adenoma patients: A randomized clinical trial.Mol Carcinog. 2019 Apr;58(4):511-523. doi: 10.1002/mc.22945. Epub 2018 Dec 21.
• [15] Prognostic value of tissue protein expression levels of MIB-1 (Ki-67) in Danish ovarian cancer patients. From the 'MALOVA' ovarian cancer study.APMIS. 2013 Dec;121(12):1177-86. doi: 10.1111/apm.12071. Epub 2013 Apr 18.
• [16] MIB-1 index is unlikely to predict relapse-free survival in patients who underwent R0-esophagectomy for esophageal squamous cell carcinoma.Dis Esophagus. 2018 May 1;31(5). doi: 10.1093/dote/dox145.
• [17] Phase II study of protracted daily temozolomide for low-grade gliomas in adults.Clin Cancer Res. 2009 Jan 1;15(1):330-7. doi: 10.1158/1078-0432.CCR-08-0888.
• [18] Clinicopathological study of vascular endothelial growth factor (VEGF), p53, and proliferative potential in familial von Hippel-Lindau disease and sporadic hemangioblastomas.Brain Tumor Pathol. 2000;17(3):111-20. doi: 10.1007/BF02484282.
• [19] WHO grade, proliferation index, and progesterone receptor expression are different according to the location of meningioma.Acta Neurochir (Wien). 2019 Dec;161(12):2553-2561. doi: 10.1007/s00701-019-04084-z. Epub 2019 Oct 21.
• [20] Expression of vascular endothelial growth factor and proliferation marker MIB1 are influenced by neoadjuvant chemotherapy in locally advanced breast cancer.Appl Immunohistochem Mol Morphol. 2005 Jun;13(2):147-56. doi: 10.1097/01.pai.0000137364.36091.b0.
• [21] CytoLyt fixation significantly inhibits MIB1 immunoreactivity whereas alternative Ki-67 clone 30-9 is not susceptible to the inhibition: Critical diagnostic implications.Cancer Cytopathol. 2019 Oct;127(10):643-649. doi: 10.1002/cncy.22170. Epub 2019 Aug 9.
• [22] -tubulin nuclear overexpression is an indicator of poor prognosis in patients with non-Hodgkin's lymphoma.Int J Mol Med. 2014 Aug;34(2):483-90. doi: 10.3892/ijmm.2014.1793. Epub 2014 Jun 4.
• [23] Immunohistochemical staining of palisading basal cells in Bowen's disease and basal involvement in actinic keratosis: contrasting staining patterns suggest different cells of origin.Am J Dermatopathol. 2008 Apr;30(2):123-6. doi: 10.1097/DAD.0b013e3181658062.
• [24] Overexpression of DNA methyltransferases 1, 3a, and 3b significantly correlates with retinoblastoma tumorigenesis.Am J Clin Pathol. 2010 Nov;134(5):826-34. doi: 10.1309/AJCPHGQ69FXDFWII.
• [25] Close correlation between CXCR4 and VEGF expression and frequent CXCR7 expression in rhabdomyosarcoma.Hum Pathol. 2014 Sep;45(9):1900-9. doi: 10.1016/j.humpath.2014.05.012. Epub 2014 Jun 12.
• [26] HLA haplotypes and susceptibility to rheumatoid arthritis. More than class II genes.Scand J Rheumatol. 2002;31(5):275-8. doi: 10.1080/030097402760375160.
• [27] Progression to large B-cell lymphoma in splenic marginal zone lymphoma: a description of a series of 12 cases.Am J Surg Pathol. 2001 Oct;25(10):1268-76. doi: 10.1097/00000478-200110000-00007.
• [28] Analysis of papillary urothelial carcinomas of the bladder with grade heterogeneity: supportive evidence for an early role of CDKN2A deletions in the FGFR3 pathway.Histopathology. 2017 Jan;70(2):281-289. doi: 10.1111/his.13063. Epub 2016 Oct 28.
• [29] Modelling genetic and clinical heterogeneity in epithelial ovarian cancers.Carcinogenesis. 2011 Oct;32(10):1540-9. doi: 10.1093/carcin/bgr140. Epub 2011 Aug 22.
• [30] Effects of supplemental vitamin D and calcium on markers of proliferation, differentiation, and apoptosis in the normal colorectal mucosa of colorectal adenoma patients.PLoS One. 2018 Dec 17;13(12):e0208762. doi: 10.1371/journal.pone.0208762. eCollection 2018.
• [31] Elevated Ki-67 (MIB-1) expression as an independent predictor for unfavorable pathologic outcomes and biochemical recurrence after radical prostatectomy in patients with localized prostate cancer: A propensity score matched study.PLoS One. 2019 Nov 7;14(11):e0224671. doi: 10.1371/journal.pone.0224671. eCollection 2019.
• [32] Mutations in the NOTCH pathway regulator MIB1 cause left ventricular noncompaction cardiomyopathy. Nat Med. 2013 Feb;19(2):193-201. doi: 10.1038/nm.3046. Epub 2013 Jan 13.
• [33] Organoid culture containing cancer cells and stromal cells reveals that podoplanin-positive cancer-associated fibroblasts enhance proliferation of lung cancer cells.Lung Cancer. 2019 Aug;134:100-107. doi: 10.1016/j.lungcan.2019.04.007. Epub 2019 Apr 8.
• [34] Clinicopathological and genomic analysis of double-hit follicular lymphoma: comparison with high-grade B-cell lymphoma with MYC and BCL2 and/or BCL6 rearrangements.Mod Pathol. 2018 Feb;31(2):313-326. doi: 10.1038/modpathol.2017.134. Epub 2017 Oct 6.
• [35] Chromosomal translocations t(4;14), t(11;14) and proliferation rate stratify patients with mature plasma cell myelomas into groups with different survival probabilities: a molecular epidemiologic study on tissue microarrays.Am J Surg Pathol. 2007 May;31(5):690-6. doi: 10.1097/01.pas.0000213399.87816.56.
• [36] Molecular markers and bladder carcinoma: Schistosomal and non-schistosomal.Clin Biochem. 2011 Feb;44(2-3):237-44. doi: 10.1016/j.clinbiochem.2010.09.028. Epub 2010 Oct 8.
• [37] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [38] Candidate Genes for Nonsyndromic Cleft Palate Detected by Exome Sequencing. J Dent Res. 2017 Oct;96(11):1314-1321. doi: 10.1177/0022034517722761. Epub 2017 Aug 2.
• [39] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [40] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [41] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [42] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [43] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [44] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [45] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [46] Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
• [47] NOTCH signaling is activated in and contributes to resistance in enzalutamide-resistant prostate cancer cells. J Biol Chem. 2019 May 24;294(21):8543-8554. doi: 10.1074/jbc.RA118.006983. Epub 2019 Apr 2.
• [48] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [49] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [50] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [51] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
• [52] Sanggenon C inhibits cell proliferation and induces apoptosis by regulating the MIB1/DAPK1 axis in glioblastoma. MedComm (2020). 2023 Jun 19;4(4):e281. doi: 10.1002/mco2.281. eCollection 2023 Aug.