Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7C68YV)

• DOT Name: Cytosolic acyl coenzyme A thioester hydrolase (ACOT7)
• Synonyms: EC 3.1.2.2; Acyl-CoA thioesterase 7; Brain acyl-CoA hydrolase; BACH; hBACH; CTE-IIa; CTE-II; Long chain acyl-CoA thioester hydrolase
• Gene Name: ACOT7
• Related Disease:
  Adult glioblastoma
  Glioblastoma multiforme
  Prostate cancer
  Prostate carcinoma
  Tuberculosis
  Acute monocytic leukemia
  Acute myelogenous leukaemia
  Adenocarcinoma
  Alzheimer disease
  Atrial fibrillation
  Breast cancer
  Breast carcinoma
  Cerebrovascular disease
  Clear cell renal carcinoma
  Dementia
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Glioma
  Head-neck squamous cell carcinoma
  Hepatitis
  Insomnia
  Malaria
  Multiple sclerosis
  Myocardial infarction
  Neoplasm
  Ovarian cancer
  Ovarian neoplasm
  Parkinson disease
  Pertussis
  Psychotic disorder
  Renal cell carcinoma
  Rheumatoid arthritis
  Schizophrenia
  Systemic sclerosis
  Bacterial infection
  Carcinoma of liver and intrahepatic biliary tract
  Hepatocellular carcinoma
  Type-1 diabetes
  Advanced cancer
  Aplasia cutis congenita
  Asthma
  Chronic obstructive pulmonary disease
  Corpus callosum, agenesis of
  Liver cancer
  Lung cancer
  Lung carcinoma
  Mental disorder
  Non-insulin dependent diabetes
• UniProt ID: BACH_HUMAN
• PDB ID: 2QQ2
• EC Number: 3.1.2.2
• Pfam ID: PF03061
• Sequence:
  MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITGRIM
  RPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGERCVAALARVERTDFLSPMCIGE
  VAHVSAEITYTSKHSVEVQVNVMSENILTGAKKLTNKATLWYVPLSLKNVDKVLEVPPVV
  YSRQEQEEEGRKRYEAQKLERMETKWRNGDIVQPVLNPEPNTVSYSQSSLIHLVGPSDCT
  LHGFVHGGVTMKLMDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGRMTFTS
  NKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSLSQEGRSLPVPQLVPETEDEKKRFEE
  GKGRYLQMKAKRQGHAEPQP
• Function: Catalyzes the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating their respective intracellular levels. Preferentially hydrolyzes palmitoyl-CoA, but has a broad specificity acting on other fatty acyl-CoAs with chain-lengths of C8-C18. May play an important physiological function in brain.
• Tissue Specificity: Isoform 4 is expressed exclusively in brain.
• KEGG Pathway:
  Fatty acid elongation (hsa00062)
  Biosynthesis of unsaturated fatty acids (hsa01040)
  Metabolic pathways (hsa01100)
• Reactome Pathway: Mitochondrial Fatty Acid Beta-Oxidation (R-HSA-77289)
• BioCyc Pathway: MetaCyc:HS01875-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Definitive	Biomarker	[1]
Glioblastoma multiforme	DISK8246	Definitive	Biomarker	[1]
Prostate cancer	DISF190Y	Definitive	Biomarker	[2]
Prostate carcinoma	DISMJPLE	Definitive	Biomarker	[2]
Tuberculosis	DIS2YIMD	Definitive	Genetic Variation	[3]
Acute monocytic leukemia	DIS28NEL	Strong	Altered Expression	[4]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[4]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[5]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[7]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[7]
Cerebrovascular disease	DISAB237	Strong	Genetic Variation	[8]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[9]
Dementia	DISXL1WY	Strong	Altered Expression	[10]
Epithelial ovarian cancer	DIS56MH2	Strong	Genetic Variation	[11]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Genetic Variation	[12]
Glioma	DIS5RPEH	Strong	Genetic Variation	[13]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[14]
Hepatitis	DISXXX35	Strong	Genetic Variation	[15]
Insomnia	DIS0AFR7	Strong	Biomarker	[16]
Malaria	DISQ9Y50	Strong	Biomarker	[17]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[18]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[19]
Neoplasm	DISZKGEW	Strong	Altered Expression	[20]
Ovarian cancer	DISZJHAP	Strong	Genetic Variation	[11]
Ovarian neoplasm	DISEAFTY	Strong	Genetic Variation	[11]
Parkinson disease	DISQVHKL	Strong	Biomarker	[21]
Pertussis	DISQZUE7	Strong	Biomarker	[22]
Psychotic disorder	DIS4UQOT	Strong	Biomarker	[23]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[9]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[24]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[25]
Systemic sclerosis	DISF44L6	Strong	Altered Expression	[26]
Bacterial infection	DIS5QJ9S	moderate	Altered Expression	[27]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	moderate	Biomarker	[28]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[28]
Type-1 diabetes	DIS7HLUB	moderate	Genetic Variation	[29]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[9]
Aplasia cutis congenita	DISMDAYM	Limited	Biomarker	[30]
Asthma	DISW9QNS	Limited	Biomarker	[31]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Genetic Variation	[32]
Corpus callosum, agenesis of	DISO9P40	Limited	Biomarker	[30]
Liver cancer	DISDE4BI	Limited	Biomarker	[28]
Lung cancer	DISCM4YA	Limited	Altered Expression	[33]
Lung carcinoma	DISTR26C	Limited	Altered Expression	[33]
Mental disorder	DIS3J5R8	Limited	Biomarker	[23]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[34]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Cytosolic acyl coenzyme A thioester hydrolase (ACOT7) affects the response to substance of Fluorouracil.	[52]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[35]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[36]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[37]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[38]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[39]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[40]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[43]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[44]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[45]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[46]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[48]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[49]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[50]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[39]
CITCO	DM0N634	Investigative	CITCO increases the expression of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[51]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[41]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[42]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Cytosolic acyl coenzyme A thioester hydrolase (ACOT7).	[42]

References

• [1] Rindopepimut with temozolomide for patients with newly diagnosed, EGFRvIII-expressing glioblastoma (ACT IV): a randomised, double-blind, international phase 3 trial.Lancet Oncol. 2017 Oct;18(10):1373-1385. doi: 10.1016/S1470-2045(17)30517-X. Epub 2017 Aug 23.
• [2] Early Response Monitoring Following Radiation Therapy by Using [(18)F]FDG and [(11)C]Acetate PET in Prostate Cancer Xenograft Model with Metabolomics Corroboration.Molecules. 2017 Nov 10;22(11):1946. doi: 10.3390/molecules22111946.
• [3] Mutations in lysX as the new and reliable markers for tuberculosis Beijing and modern Beijing strains.Tuberculosis (Edinb). 2016 Mar;97:33-7. doi: 10.1016/j.tube.2015.12.006. Epub 2015 Dec 29.
• [4] Expression level of ACOT7 influences the prognosis in acute myeloid leukemia patients.Cancer Biomark. 2019;26(4):441-449. doi: 10.3233/CBM-182287.
• [5] Inflammatory markers in Alzheimer's disease and mild cognitive impairment: a meta-analysis and systematic review of 170 studies.J Neurol Neurosurg Psychiatry. 2019 May;90(5):590-598. doi: 10.1136/jnnp-2018-319148. Epub 2019 Jan 10.
• [6] Paroxysmal Atrial Fibrillation in the Course of Acute Pulmonary Embolism: Clinical Significance and Impact on Prognosis.Biomed Res Int. 2017;2017:5049802. doi: 10.1155/2017/5049802. Epub 2017 Feb 9.
• [7] Association of vitamin D receptor gene polymorphisms with breast cancer risk in an Egyptian population.Tumour Biol. 2017 Oct;39(10):1010428317727738. doi: 10.1177/1010428317727738.
• [8] alpha-1-Antichymotrypsin gene A1252G variant (ACT Isehara-1) is associated with a lacunar type of ischemic cerebrovascular disease.J Hum Genet. 2001;46(1):45-7. doi: 10.1007/s100380170125.
• [9] Dual-Tracer PET/CT Differentiates 2 Types of Primary Cancers and Metastases in a Patient With Crossed Fused Renal Ectopia.Clin Nucl Med. 2019 Feb;44(2):157-158. doi: 10.1097/RLU.0000000000002390.
• [10] Alpha1-antichymotrypsin, an inflammatory protein overexpressed in Alzheimer's disease brain, induces tau phosphorylation in neurons.Brain. 2006 Nov;129(Pt 11):3020-34. doi: 10.1093/brain/awl255. Epub 2006 Sep 20.
• [11] Breast and ovarian cancer referrals to the ACT Genetic Service: are we meeting guidelines?.Intern Med J. 2017 Mar;47(3):311-317. doi: 10.1111/imj.13357.
• [12] Association between the genetic variations within TBX21 gene promoter and the clinicopathological characteristics of esophageal squamous cell carcinoma in a high-risk Chinese population.Tumour Biol. 2015 May;36(5):3985-93. doi: 10.1007/s13277-015-3042-x. Epub 2015 Jan 11.
• [13] Possible association between polymorphisms of human vascular endothelial growth factor A gene and susceptibility to glioma in a Chinese population.Int J Cancer. 2011 Jan 1;128(1):166-75. doi: 10.1002/ijc.25306.
• [14] Ionizing radiation and TNF-alpha and stimulated expression of alpha1-antichymotrypsin gene in human squamous carcinoma cells.Acta Oncol. 1998;37(5):475-8. doi: 10.1080/028418698430430.
• [15] Enhancement of hepatitis virus immunoassay outcome predictions in imbalanced routine pathology data by data balancing and feature selection before the application of support vector machines.BMC Med Inform Decis Mak. 2017 Aug 14;17(1):121. doi: 10.1186/s12911-017-0522-5.
• [16] Clinical pharmacology of the dual orexin receptor antagonist ACT-541468 in elderly subjects: Exploration of pharmacokinetics, pharmacodynamics and tolerability following single-dose morning and repeated-dose evening administration.J Psychopharmacol. 2020 Mar;34(3):326-335. doi: 10.1177/0269881119882854. Epub 2019 Oct 23.
• [17] Mass drug administration can be a valuable addition to the malaria elimination toolbox.Malar J. 2019 Aug 22;18(1):281. doi: 10.1186/s12936-019-2906-8.
• [18] Using mixed methods case-series evaluation in the development of a guided self-management hybrid CBT and ACT intervention for multiple sclerosis pain.Disabil Rehabil. 2017 Sep;39(18):1785-1798. doi: 10.1080/09638288.2016.1209580. Epub 2016 Aug 24.
• [19] Effects of l-arginine supplementation associated with continuous or interval aerobic training on chronic heart failure rats.Metabolism. 2017 Nov;76:1-10. doi: 10.1016/j.metabol.2017.06.009. Epub 2017 Jul 5.
• [20] Bispecific Antibodies Enable Synthetic Agonistic Receptor-Transduced T Cells for Tumor Immunotherapy.Clin Cancer Res. 2019 Oct 1;25(19):5890-5900. doi: 10.1158/1078-0432.CCR-18-3927. Epub 2019 Jul 8.
• [21] Genetic study of apolipoprotein E gene, alpha-1 antichymotrypsin gene in sporadic Parkinson disease.Am J Med Genet. 2002 May 8;114(4):446-9. doi: 10.1002/ajmg.10249.
• [22] Membrane Permeabilization by Pore-Forming RTX Toxins: What Kind of Lesions Do These Toxins Form?.Toxins (Basel). 2019 Jun 18;11(6):354. doi: 10.3390/toxins11060354.
• [23] Outcomes of clients in need of intensive team care in Flexible Assertive Community Treatment in Sweden.Nord J Psychiatry. 2018 Apr;72(3):226-231. doi: 10.1080/08039488.2018.1430168. Epub 2018 Jan 26.
• [24] Efficacy of tocilizumab monotherapy after response to combined tocilizumab and methotrexate in patients with rheumatoid arthritis: the randomised JUST-ACT study.Clin Exp Rheumatol. 2019 May-Jun;37(3):437-444. Epub 2018 Sep 17.
• [25] Association of CCL11 promoter polymorphisms with schizophrenia in a Korean population.Gene. 2018 May 20;656:80-85. doi: 10.1016/j.gene.2018.02.053. Epub 2018 Feb 22.
• [26] Effects of selexipag and its active metabolite in contrasting the profibrotic myofibroblast activity in cultured scleroderma skin fibroblasts.Arthritis Res Ther. 2018 May 2;20(1):77. doi: 10.1186/s13075-018-1577-0.
• [27] Phospholipase A activity of adenylate cyclase toxin mediates translocation of its adenylate cyclase domain.Proc Natl Acad Sci U S A. 2017 Aug 15;114(33):E6784-E6793. doi: 10.1073/pnas.1701783114. Epub 2017 Jul 31.
• [28] Alpha1-ACT Functions as a Tumour Suppressor in Hepatocellular Carcinoma by Inhibiting the PI3K/AKT/mTOR Signalling Pathway via Activation of PTEN.Cell Physiol Biochem. 2017;41(6):2289-2306. doi: 10.1159/000475648. Epub 2017 Apr 26.
• [29] No abnormalities of reg1 alpha and reg1 beta gene associated with diabetes mellitus.Diabetes Res Clin Pract. 2002 Feb;55(2):105-11. doi: 10.1016/s0168-8227(01)00321-7.
• [30] Adrenocortical carcinoma -- improving patient care by establishing new structures.Exp Clin Endocrinol Diabetes. 2006 Feb;114(2):45-51. doi: 10.1055/s-2006-923808.
• [31] A Pragmatic Trial of Symptom-Based Inhaled Corticosteroid Use in African-American Children with Mild Asthma.J Allergy Clin Immunol Pract. 2020 Jan;8(1):176-185.e2. doi: 10.1016/j.jaip.2019.06.030. Epub 2019 Jul 30.
• [32] COPD patients prescribed inhaled corticosteroid in general practice: Based on disease characteristics according to guidelines?.Chron Respir Dis. 2019 Jan-Dec;16:1479973119867949. doi: 10.1177/1479973119867949.
• [33] Acyl-CoA thioesterase 7 is involved in cell cycle progression via regulation of PKC-p53-p21 signaling pathway.Cell Death Dis. 2017 May 18;8(5):e2793. doi: 10.1038/cddis.2017.202.
• [34] Decreased tolbutamide-stimulated insulin secretion in healthy subjects with sequence variants in the high-affinity sulfonylurea receptor gene.Diabetes. 1998 Apr;47(4):598-605. doi: 10.2337/diabetes.47.4.598.
• [35] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [36] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [37] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [38] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [39] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [40] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [41] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [42] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [43] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [44] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [45] Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
• [46] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [47] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [48] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [49] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [50] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [51] Farnesol induces fatty acid oxidation and decreases triglyceride accumulation in steatotic HepaRG cells. Toxicol Appl Pharmacol. 2019 Feb 15;365:61-70.
• [52] Mechanistic and predictive profiling of 5-Fluorouracil resistance in human cancer cells. Cancer Res. 2004 Nov 15;64(22):8167-76. doi: 10.1158/0008-5472.CAN-04-0970.