Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7IEBWZ)

DOT Name	Sarcalumenin (SRL)
Gene Name	SRL
Related Disease	Nephropathy ( ) OPTN-related open angle glaucoma ( ) Type-1 diabetes ( ) Acromegaly ( ) Acute myelogenous leukaemia ( ) African trypanosomiasis ( ) Alzheimer disease ( ) Atopic dermatitis ( ) Breast cancer ( ) Breast carcinoma ( ) Chromosomal disorder ( ) Colorectal carcinoma ( ) Disease of orbital part of eye adnexa ( ) Drug-resistant tuberculosis ( ) Endometriosis ( ) Influenza ( ) Lung cancer ( ) Lung carcinoma ( ) Measles ( ) Myelodysplastic syndrome ( ) Neuralgia ( ) Non-insulin dependent diabetes ( ) Non-small-cell lung cancer ( ) Pancreatic cancer ( ) Prostate cancer ( ) Prostate carcinoma ( ) Rheumatoid arthritis ( ) Seasonal allergic rhinitis ( ) Triple negative breast cancer ( ) Tuberculosis ( ) Type-1/2 diabetes ( ) Zika virus infection ( ) Age-related macular degeneration ( ) Acute lymphocytic leukaemia ( ) Adult glioblastoma ( ) Advanced cancer ( ) Arrhythmia ( ) Clear cell renal carcinoma ( ) Glioblastoma multiforme ( ) Hepatitis C virus infection ( ) Melanoma ( ) Renal cell carcinoma ( )
UniProt ID	SRCA_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00350 ; PF16880
Sequence	MRALVLLGCLLASLLFSGQAEETEDANEEAPLRDRSHIEKTLMLNEDKPSDDYSAVLQRL RKIYHSSIKPLEQSYKYNELRQHEITDGEITSKPMVLFLGPWSVGKSTMINYLLGLENTR YQLYTGAEPTTSEFTVLMHGPKLKTIEGIVMAADSARSFSPLEKFGQNFLEKLIGIEVPH KLLERVTFVDTPGIIENRKQQERGYPFNDVCQWFIDRADLIFVVFDPTKLDVGLELEMLF RQLKGRESQIRIILNKADNLATQMLMRVYGALFWSLAPLINVTEPPRVYVSSFWPQEYKP DTHQELFLQEEISLLEDLNQVIENRLENKIAFIRQHAIRVRIHALLVDRYLQTYKDKMTF FSDGELVFKDIVEDPDKFYIFKTILAKTNVSKFDLPNREAYKDFFGINPISSFKLLSQQC SYMGGCFLEKIERAITQELPGLLGSLGLGKNPGALNCDKTGCSETPKNRYRKH

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Nephropathy	DISXWP4P	Definitive	Biomarker	[1]
OPTN-related open angle glaucoma	DISDR98A	Definitive	Genetic Variation	[2]
Type-1 diabetes	DIS7HLUB	Definitive	Biomarker	[3]
Acromegaly	DISCC73U	Strong	Biomarker	[4]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[5]
African trypanosomiasis	DISBIXK4	Strong	Biomarker	[6]
Alzheimer disease	DISF8S70	Strong	Biomarker	[7]
Atopic dermatitis	DISTCP41	Strong	Altered Expression	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Chromosomal disorder	DISM5BB5	Strong	Biomarker	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[11]
Disease of orbital part of eye adnexa	DISGWPWX	Strong	Biomarker	[12]
Drug-resistant tuberculosis	DIS5BUFB	Strong	Biomarker	[13]
Endometriosis	DISX1AG8	Strong	Biomarker	[14]
Influenza	DIS3PNU3	Strong	Biomarker	[15]
Lung cancer	DISCM4YA	Strong	Biomarker	[16]
Lung carcinoma	DISTR26C	Strong	Biomarker	[16]
Measles	DISXSUID	Strong	Biomarker	[17]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[18]
Neuralgia	DISWO58J	Strong	Biomarker	[19]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[20]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[21]
Pancreatic cancer	DISJC981	Strong	Altered Expression	[22]
Prostate cancer	DISF190Y	Strong	Biomarker	[23]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[23]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[24]
Seasonal allergic rhinitis	DIS58KQX	Strong	Biomarker	[25]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[26]
Tuberculosis	DIS2YIMD	Strong	Altered Expression	[27]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[28]
Zika virus infection	DISQUCTY	Strong	Biomarker	[29]
Age-related macular degeneration	DIS0XS2C	moderate	Biomarker	[30]
Acute lymphocytic leukaemia	DISPX75S	Limited	Genetic Variation	[31]
Adult glioblastoma	DISVP4LU	Limited	Altered Expression	[32]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[33]
Arrhythmia	DISFF2NI	Limited	Biomarker	[34]
Clear cell renal carcinoma	DISBXRFJ	Limited	Genetic Variation	[35]
Glioblastoma multiforme	DISK8246	Limited	Altered Expression	[32]
Hepatitis C virus infection	DISQ0M8R	Limited	Biomarker	[36]
Melanoma	DIS1RRCY	Limited	Biomarker	[37]
Renal cell carcinoma	DISQZ2X8	Limited	Genetic Variation	[35]
------------------------------------------------------------------------------------


⏷ Show the Full List of 42 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Sarcalumenin (SRL).	[38]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Sarcalumenin (SRL).	[42]
------------------------------------------------------------------------------------

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Sarcalumenin (SRL).	[39]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Sarcalumenin (SRL).	[40]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Sarcalumenin (SRL).	[41]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Sarcalumenin (SRL).	[43]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Sarcalumenin (SRL).	[44]
------------------------------------------------------------------------------------

References

1	Proteinuria and baseline renal function predict mortality and renal outcomes after sirolimus therapy in liver transplantation recipients.BMC Gastroenterol. 2017 Apr 20;17(1):58. doi: 10.1186/s12876-017-0611-z.
2	Swept-source OCT angiography imaging of the macular capillary network in glaucoma.Br J Ophthalmol. 2017 Aug 9:bjophthalmol-2016-309816. doi: 10.1136/bjophthalmol-2016-309816. Online ahead of print.
3	Safety and Tolerability of Insulin Aspart Biosimilar SAR341402 Versus Originator Insulin Aspart (NovoLog) When Used in Insulin Pumps in Adults with Type 1 Diabetes: A Randomized, Open-Label Clinical Trial.Diabetes Technol Ther. 2020 Sep;22(9):666-673. doi: 10.1089/dia.2019.0446. Epub 2020 Jan 28.
4	Somatostatin receptor ligands and resistance to treatment in pituitary adenomas.J Mol Endocrinol. 2014 Jun;52(3):R223-40. doi: 10.1530/JME-14-0011. Epub 2014 Mar 19.
5	Discovery of novel glycogen synthase kinase-3 inhibitors: Structure-based virtual screening, preliminary SAR and biological evaluation for treatment of acute myeloid leukemia.Eur J Med Chem. 2019 Jun 1;171:221-234. doi: 10.1016/j.ejmech.2019.03.039. Epub 2019 Mar 20.
6	African trypanosomiasis: Synthesis & SAR enabling novel drug discovery of ubiquinol mimics for trypanosome alternative oxidase.Eur J Med Chem. 2017 Dec 1;141:676-689. doi: 10.1016/j.ejmech.2017.09.067. Epub 2017 Oct 6.
7	Drug likeness, targets, molecular docking and ADMET studies for some indolizine derivatives.Pharmazie. 2018 Nov 1;73(11):635-642. doi: 10.1691/ph.2018.8061.
8	Identification of highly expressed genes in peripheral blood T cells from patients with atopic dermatitis.Int Arch Allergy Immunol. 2002 Dec;129(4):327-40. doi: 10.1159/000067589.
9	Pharmacological explorations of eco-friendly amide substituted (Z)--enaminones as anti-breast cancer drugs.Arch Pharm (Weinheim). 2019 Jan;352(1):e1800244. doi: 10.1002/ardp.201800244. Epub 2018 Dec 5.
10	Construction and application of (Q)SAR models to predict chemical-induced in vitro chromosome aberrations.Regul Toxicol Pharmacol. 2018 Nov;99:274-288. doi: 10.1016/j.yrtph.2018.09.026. Epub 2018 Sep 29.
11	ASR352, A potent anticancer agent: Synthesis, preliminary SAR, and biological activities against colorectal cancer bulk, 5-fluorouracil/oxaliplatin resistant and stem cells.Eur J Med Chem. 2019 Jan 1;161:456-467. doi: 10.1016/j.ejmech.2018.10.052. Epub 2018 Oct 23.
12	Comparison of Orbit-Based and Time-Offset-Based Geometric Correction Models for SAR Satellite Imagery Based on Error Simulation.Sensors (Basel). 2017 Jan 17;17(1):170. doi: 10.3390/s17010170.
13	Synthesis and SAR evaluation of novel thioridazine derivatives active against drug-resistant tuberculosis.Eur J Med Chem. 2017 Feb 15;127:147-158. doi: 10.1016/j.ejmech.2016.12.042. Epub 2016 Dec 23.
14	Synthesis and biological evaluation of 3-(2-aminoethyl) uracil derivatives as gonadotropin-releasing hormone (GnRH) receptor antagonists.Eur J Med Chem. 2018 Feb 10;145:413-424. doi: 10.1016/j.ejmech.2017.12.095. Epub 2018 Jan 2.
15	2D-SAR, Topomer CoMFA and molecular docking studies on avian influenza neuraminidase inhibitors.Comput Struct Biotechnol J. 2018 Dec 7;17:39-48. doi: 10.1016/j.csbj.2018.11.007. eCollection 2019.
16	Development of novel phenoxy-diketopiperazine-type plinabulin derivatives as potent antimicrotubule agents based on the co-crystal structure.Bioorg Med Chem. 2020 Jan 1;28(1):115186. doi: 10.1016/j.bmc.2019.115186. Epub 2019 Nov 11.
17	Optimising measles virus-guided radiovirotherapy with external beam radiotherapy and specific checkpoint kinase 1 inhibition.Radiother Oncol. 2013 Jul;108(1):24-31. doi: 10.1016/j.radonc.2013.05.036. Epub 2013 Jul 9.
18	In Vitro and in Vivo Evaluation of Fully Substituted (5-(3-Ethoxy-3-oxopropynyl)-4-(ethoxycarbonyl)-1,2,3-triazolyl-glycosides as Original Nucleoside Analogues to Circumvent Resistance in Myeloid Malignancies.J Med Chem. 2017 Feb 23;60(4):1523-1533. doi: 10.1021/acs.jmedchem.6b01803. Epub 2017 Feb 2.
19	Pyrrolinone derivatives as a new class of P2X3 receptor antagonists Part 2: Discovery of orally bioavailable compounds.Bioorg Med Chem Lett. 2019 Mar 1;29(5):688-693. doi: 10.1016/j.bmcl.2019.01.039. Epub 2019 Feb 1.
20	Identification of BR101549 as a lead candidate of non-TZD PPAR agonist for the treatment of type 2 diabetes: Proof-of-concept evaluation and SAR.Bioorg Med Chem Lett. 2019 Feb 15;29(4):631-637. doi: 10.1016/j.bmcl.2018.12.043. Epub 2018 Dec 19.
21	Synthesis, anti-proliferative activity, SAR study, and preliminary in vivo toxicity study of substituted N,N'-bis(arylmethyl)benzimidazolium salts against a panel of non-small cell lung cancer cell lines.Bioorg Med Chem. 2017 Jan 1;25(1):421-439. doi: 10.1016/j.bmc.2016.11.009. Epub 2016 Nov 5.
22	Novel synthetic chalcones induce apoptosis in the A549 non-small cell lung cancer cells harboring a KRAS mutation.Bioorg Med Chem Lett. 2016 Dec 1;26(23):5703-5706. doi: 10.1016/j.bmcl.2016.10.063. Epub 2016 Oct 24.
23	Update of the Standard Operating Procedure on the Use of Multiparametric Magnetic Resonance Imaging for the Diagnosis, Staging and Management of Prostate Cancer.J Urol. 2020 Apr;203(4):706-712. doi: 10.1097/JU.0000000000000617. Epub 2019 Oct 23.
24	Synthesis and activity of substituted 4-(indazol-3-yl)phenols as pathway-selective estrogen receptor ligands useful in the treatment of rheumatoid ... J Med Chem. 2004 Dec 16;47(26):6435-8.
25	Role of IL-35 in sublingual allergen immunotherapy.J Allergy Clin Immunol. 2019 Mar;143(3):1131-1142.e4. doi: 10.1016/j.jaci.2018.06.041. Epub 2018 Jul 25.
26	SAR optimization studies on a novel series of 2-anilinopyrimidines as selective inhibitors against triple-negative breast cancer cell line MDA-MB-468.Bioorg Med Chem Lett. 2019 Dec 15;29(24):126752. doi: 10.1016/j.bmcl.2019.126752. Epub 2019 Oct 24.
27	Novel Antimycobacterial Compounds Suppress NAD Biogenesis by Targeting a Unique Pocket of NaMN Adenylyltransferase.ACS Chem Biol. 2019 May 17;14(5):949-958. doi: 10.1021/acschembio.9b00124. Epub 2019 Apr 17.
28	Structure based docking and molecular dynamics studies: Peroxisome proliferator-activated receptors -/ dual agonists for treatment of metabolic disorders.J Biomol Struct Dyn. 2020 Feb;38(2):511-523. doi: 10.1080/07391102.2019.1581089. Epub 2019 Mar 11.
29	Design, synthesis and discovery of andrographolide derivatives against Zika virus infection.Eur J Med Chem. 2020 Feb 1;187:111925. doi: 10.1016/j.ejmech.2019.111925. Epub 2019 Nov 30.
30	Multimodal Evaluation of the Fellow Eye of Patients with Retinal Angiomatous Proliferation.Ophthalmic Res. 2018;59(2):88-97. doi: 10.1159/000481262. Epub 2017 Oct 25.
31	Matrix association region/scaffold attachment region: the crucial player in defining the positions of chromosome breaks mediated by bile acid-induced apoptosis in nasopharyngeal epithelial cells.BMC Med Genomics. 2019 Jan 15;12(1):9. doi: 10.1186/s12920-018-0465-4.
32	Preliminary SAR on indole-3-carbinol and related fragments reveals a novel anticancer lead compound against resistant glioblastoma cells.Bioorg Med Chem Lett. 2017 Apr 1;27(7):1561-1565. doi: 10.1016/j.bmcl.2017.02.033. Epub 2017 Feb 17.
33	Synthesis of New Derivatives of Benzofuran as Potential Anticancer Agents.Molecules. 2019 Apr 18;24(8):1529. doi: 10.3390/molecules24081529.
34	Development of models for predicting Torsade de Pointes cardiac arrhythmias using perceptron neural networks.BMC Bioinformatics. 2017 Dec 28;18(Suppl 14):497. doi: 10.1186/s12859-017-1895-2.
35	Standardized report template for indeterminate renal masses at CT and MRI: a collaborative product of the SAR Disease-Focused Panel on Renal Cell Carcinoma.Abdom Radiol (NY). 2019 Apr;44(4):1423-1429. doi: 10.1007/s00261-018-1851-2.
36	Design, synthesis, and structure-activity relationships of novel imidazo[4,5-c]pyridine derivatives as potent non-nucleoside inhibitors of hepatitis C virus NS5B.Bioorg Med Chem. 2018 May 15;26(9):2621-2631. doi: 10.1016/j.bmc.2018.04.029. Epub 2018 Apr 16.
37	A one-pot laccase-catalysed synthesis of coumestan derivatives and their anticancer activity.Bioorg Med Chem. 2017 Feb 1;25(3):1172-1182. doi: 10.1016/j.bmc.2016.12.025. Epub 2016 Dec 21.
38	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
39	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
40	Inorganic arsenic exposure promotes malignant progression by HDAC6-mediated down-regulation of HTRA1. J Appl Toxicol. 2023 Aug;43(8):1214-1224. doi: 10.1002/jat.4457. Epub 2023 Mar 11.
41	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
42	Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
43	CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
44	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.