Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7OG7Y2)

• DOT Name: HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1)
• Synonyms: DP(W3); DP(W4); HLA-SB alpha chain; MHC class II DP3-alpha; MHC class II DPA1
• Gene Name: HLA-DPA1
• Related Disease:
  Ataxia-telangiectasia
  Acute graft versus host disease
  Anca-associated vasculitis
  Angle-closure glaucoma
  Ankylosing spondylitis
  Autism
  Autism spectrum disorder
  Autoimmune disease
  Carpal tunnel syndrome
  Chronic obstructive pulmonary disease
  Coeliac disease
  Dermatomyositis
  Diabetic kidney disease
  Dilated cardiomyopathy 1A
  Haematological malignancy
  Hepatitis B virus infection
  Hepatitis C virus infection
  Hepatocellular carcinoma
  IgA nephropathy
  Irritant contact dermatitis
  Juvenile idiopathic arthritis
  Nephropathy
  Osteoarthritis
  Pervasive developmental disorder
  Primary angle-closure glaucoma
  Pulmonary arterial hypertension
  Pulmonary tuberculosis
  Sarcoidosis
  Systemic lupus erythematosus
  Systemic sclerosis
  Thrombocytopenia
  Thrombocytosis disease
  Tuberculosis
  Type-1 diabetes
  Asthma
  Duodenal ulcer
  Gastric ulcer
  Gastritis
  Stroke
  Allergic asthma
  Chronic hepatitis B virus infection
  Inflammatory bowel disease
  Myasthenia gravis
  Neoplasm
  Primary biliary cholangitis
  Schistosomiasis
• UniProt ID: DPA1_HUMAN
• PDB ID: 3LQZ; 4P4K; 4P4R; 4P57; 4P5K; 4P5M; 7T2A; 7T2B; 7T2C; 7T2D
• Pfam ID: PF07654 ; PF00993
• Sequence:
  MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDED
  EMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEV
  TVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFH
  YLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVG
  TVLIIKSLRSGHDPRAQGTL
• Function: Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading.
• KEGG Pathway:
  Phagosome (hsa04145)
  Cell adhesion molecules (hsa04514)
  Antigen processing and presentation (hsa04612)
  Hematopoietic cell lineage (hsa04640)
  Th1 and Th2 cell differentiation (hsa04658)
  Th17 cell differentiation (hsa04659)
  Intesti.l immune network for IgA production (hsa04672)
  Type I diabetes mellitus (hsa04940)
  Leishmaniasis (hsa05140)
  Toxoplasmosis (hsa05145)
  Staphylococcus aureus infection (hsa05150)
  Tuberculosis (hsa05152)
  Influenza A (hsa05164)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Herpes simplex virus 1 infection (hsa05168)
  Epstein-Barr virus infection (hsa05169)
  Asthma (hsa05310)
  Autoimmune thyroid disease (hsa05320)
  Inflammatory bowel disease (hsa05321)
  Systemic lupus erythematosus (hsa05322)
  Rheumatoid arthritis (hsa05323)
  Allograft rejection (hsa05330)
  Graft-versus-host disease (hsa05332)
  Viral myocarditis (hsa05416)
• Reactome Pathway:
  Phosphorylation of CD3 and TCR zeta chains (R-HSA-202427)
  Translocation of ZAP-70 to Immunological synapse (R-HSA-202430)
  Generation of second messenger molecules (R-HSA-202433)
  MHC class II antigen presentation (R-HSA-2132295)
  PD-1 signaling (R-HSA-389948)
  Interferon gamma signaling (R-HSA-877300)
  Downstream TCR signaling (R-HSA-202424)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Ataxia-telangiectasia	DISP3EVR	Definitive	Genetic Variation	[1]
Acute graft versus host disease	DIS8KLVM	Strong	Biomarker	[2]
Anca-associated vasculitis	DISU3CNU	Strong	SusceptibilityMutation	[3]
Angle-closure glaucoma	DISZ95KY	Strong	Genetic Variation	[4]
Ankylosing spondylitis	DISRC6IR	Strong	Genetic Variation	[5]
Autism	DISV4V1Z	Strong	Genetic Variation	[6]
Autism spectrum disorder	DISXK8NV	Strong	Genetic Variation	[6]
Autoimmune disease	DISORMTM	Strong	Genetic Variation	[6]
Carpal tunnel syndrome	DISHQ3BE	Strong	Genetic Variation	[7]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Biomarker	[8]
Coeliac disease	DISIY60C	Strong	Biomarker	[9]
Dermatomyositis	DIS50C5O	Strong	Genetic Variation	[10]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[11]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Genetic Variation	[12]
Haematological malignancy	DISCDP7W	Strong	Genetic Variation	[7]
Hepatitis B virus infection	DISLQ2XY	Strong	Genetic Variation	[13]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[15]
IgA nephropathy	DISZ8MTK	Strong	Biomarker	[16]
Irritant contact dermatitis	DIS62JY3	Strong	Biomarker	[17]
Juvenile idiopathic arthritis	DISQZGBV	Strong	Biomarker	[18]
Nephropathy	DISXWP4P	Strong	Biomarker	[19]
Osteoarthritis	DIS05URM	Strong	Genetic Variation	[20]
Pervasive developmental disorder	DIS51975	Strong	Genetic Variation	[6]
Primary angle-closure glaucoma	DISX8UKZ	Strong	Genetic Variation	[4]
Pulmonary arterial hypertension	DISP8ZX5	Strong	Genetic Variation	[21]
Pulmonary tuberculosis	DIS6FLUM	Strong	Genetic Variation	[22]
Sarcoidosis	DISE5B8Z	Strong	Biomarker	[8]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[23]
Systemic sclerosis	DISF44L6	Strong	Genetic Variation	[24]
Thrombocytopenia	DISU61YW	Strong	Biomarker	[19]
Thrombocytosis disease	DISNG0P4	Strong	Biomarker	[25]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[22]
Type-1 diabetes	DIS7HLUB	Strong	Genetic Variation	[26]
Asthma	DISW9QNS	moderate	Genetic Variation	[27]
Duodenal ulcer	DISNHHCN	moderate	Biomarker	[28]
Gastric ulcer	DISBBGVO	moderate	Biomarker	[28]
Gastritis	DIS8G07K	moderate	Biomarker	[28]
Stroke	DISX6UHX	moderate	Biomarker	[29]
Allergic asthma	DISHF0H3	Limited	Genetic Variation	[30]
Chronic hepatitis B virus infection	DISHL4NT	Limited	Genetic Variation	[31]
Inflammatory bowel disease	DISGN23E	Limited	Biomarker	[32]
Myasthenia gravis	DISELRCI	Limited	Biomarker	[33]
Neoplasm	DISZKGEW	Limited	Biomarker	[34]
Primary biliary cholangitis	DIS43E0O	Limited	Genetic Variation	[35]
Schistosomiasis	DIS6PD44	Limited	Biomarker	[36]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[37]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[38]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[39]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[40]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[41]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[42]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[43]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[44]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[45]
Selenium	DM25CGV	Approved	Selenium increases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[46]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[47]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[48]
Diphenylpyraline	DMW4X37	Approved	Diphenylpyraline decreases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[49]
Fluoxetine	DM3PD2C	Approved	Fluoxetine affects the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[50]
Chlorambucil	DMRKE63	Approved	Chlorambucil affects the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[50]
Ketoprofen	DMRKXPT	Approved	Ketoprofen affects the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[50]
Hydrochlorothiazide	DMUSZHD	Approved	Hydrochlorothiazide affects the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[50]
Fenoprofen	DML5VQ0	Approved	Fenoprofen affects the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[50]
Valdecoxib	DMAY7H4	Approved	Valdecoxib affects the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[50]
Ethosuximide	DMDZ9LT	Approved	Ethosuximide affects the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[50]
Cefoxitin	DMY8NC4	Approved	Cefoxitin affects the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[50]
Cinoxacin	DM4EWNS	Approved	Cinoxacin affects the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[50]
Cephalexin	DMD5JU8	Approved	Cephalexin affects the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[50]
Aztreonam	DMDNJHG	Approved	Aztreonam affects the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[50]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[51]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[52]
Coprexa	DMA0WEK	Phase 3	Coprexa increases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[53]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[46]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[51]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[55]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[56]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of HLA class II histocompatibility antigen, DP alpha 1 chain (HLA-DPA1).	[54]

References

• [1] Association of thromboxane A2 receptor gene polymorphism with the phenotype of acetyl salicylic acid-intolerant asthma.Clin Exp Allergy. 2005 May;35(5):585-90. doi: 10.1111/j.1365-2222.2005.02220.x.
• [2] Effect of matching of class I HLA alleles on clinical outcome after transplantation of hematopoietic stem cells from an unrelated donor. Japan Marrow Donor Program.N Engl J Med. 1998 Oct 22;339(17):1177-85. doi: 10.1056/NEJM199810223391701.
• [3] Identification of Functional and Expression Polymorphisms Associated With Risk for Antineutrophil Cytoplasmic Autoantibody-Associated Vasculitis.Arthritis Rheumatol. 2017 May;69(5):1054-1066. doi: 10.1002/art.40034. Epub 2017 Apr 6.
• [4] HLA-DPA1 gene polymorphism in primary glaucoma.Eur Rev Med Pharmacol Sci. 2019 Aug;23(3 Suppl):24-30. doi: 10.26355/eurrev_201908_18623.
• [5] An update on the contribution of the MHC to AS susceptibility.Clin Rheumatol. 2014 Jun;33(6):749-57. doi: 10.1007/s10067-014-2662-7. Epub 2014 May 18.
• [6] HLA Polymorphism in Regressive and Non-Regressive Autism: A Preliminary Study.Autism Res. 2020 Feb;13(2):182-186. doi: 10.1002/aur.2217. Epub 2019 Oct 8.
• [7] Some implications of genetic biomarkers in occupational epidemiology and practice.Scand J Work Environ Health. 2004 Feb;30(1):71-9. doi: 10.5271/sjweh.767.
• [8] Genetic susceptibility to beryllium: a case-referent study of men and women of working age with sarcoidosis or other chronic lung disease.Occup Environ Med. 2015 Jan;72(1):21-7. doi: 10.1136/oemed-2014-102359. Epub 2014 Oct 10.
• [9] HLA-DPB1*04:01 Protects Genetically Susceptible Children from Celiac Disease Autoimmunity in the TEDDY Study.Am J Gastroenterol. 2015 Jun;110(6):915-20. doi: 10.1038/ajg.2015.150. Epub 2015 May 26.
• [10] Variation at HLA-DPB1 is associated with dermatomyositis in Chinese population.J Dermatol. 2016 Nov;43(11):1307-1313. doi: 10.1111/1346-8138.13397. Epub 2016 May 6.
• [11] Identification of key genes for diabetic kidney disease using biological informatics methods.Mol Med Rep. 2017 Dec;16(6):7931-7938. doi: 10.3892/mmr.2017.7666. Epub 2017 Sep 29.
• [12] Association of HLA class II DRB1, DPA1 and DPB1 polymorphism with genetic susceptibility to idiopathic dilated cardiomyopathy in Chinese Han nationality.Autoimmunity. 2006 Sep;39(6):461-7. doi: 10.1080/08916930600893709.
• [13] Relationship between HLA-DPA1 mRNA expression and susceptibility to hepatitis B.J Viral Hepat. 2019 Jan;26(1):155-161. doi: 10.1111/jvh.13012. Epub 2018 Oct 25.
• [14] Genetic variants in human leukocyte antigen-DP influence both hepatitis C virus persistence and hepatitis C virus F protein generation in the Chinese Han population.Int J Mol Sci. 2014 Jun 3;15(6):9826-43. doi: 10.3390/ijms15069826.
• [15] Diagnostic and prognostic biomarkers of Human Leukocyte Antigen complex for hepatitis B virus-related hepatocellular carcinoma.J Cancer. 2019 Aug 28;10(21):5173-5190. doi: 10.7150/jca.29655. eCollection 2019.
• [16] HLA-DP region gene polymorphism in primary IgA nephropathy: no association.Nephrol Dial Transplant. 1992;7(3):200-4. doi: 10.1093/oxfordjournals.ndt.a092105.
• [17] Association of MHC region SNPs with irritant susceptibility in healthcare workers. J Immunotoxicol. 2016 Sep;13(5):738-44. doi: 10.3109/1547691X.2016.1173135. Epub 2016 Jun 3.
• [18] Immunogenetics of juvenile idiopathic arthritis: A comprehensive review.J Autoimmun. 2015 Nov;64:113-24. doi: 10.1016/j.jaut.2015.08.002. Epub 2015 Aug 21.
• [19] Thrombocytopenia and kidney disease in mice with a mutation in the C1galt1 gene.Proc Natl Acad Sci U S A. 2006 Oct 31;103(44):16442-7. doi: 10.1073/pnas.0607872103. Epub 2006 Oct 24.
• [20] Identification of new therapeutic targets for osteoarthritis through genome-wide analyses of UK Biobank data. Nat Genet. 2019 Feb;51(2):230-236.
• [21] Genetic determinants of risk in pulmonary arterial hypertension: international genome-wide association studies and meta-analysis.Lancet Respir Med. 2019 Mar;7(3):227-238. doi: 10.1016/S2213-2600(18)30409-0. Epub 2018 Dec 5.
• [22] Association of human leukocyte antigens-DQB2/DPA1/DPB1 polymorphism and pulmonary tuberculosis in the Chinese Uygur population.Mol Genet Genomic Med. 2019 Mar;7(3):e544. doi: 10.1002/mgg3.544. Epub 2019 Jan 1.
• [23] HLA-DP does not contribute towards susceptibility to systemic lupus erythematosus.Ann Rheum Dis. 1994 Mar;53(3):188-90. doi: 10.1136/ard.53.3.188.
• [24] Identification of novel genetic markers associated with clinical phenotypes of systemic sclerosis through a genome-wide association strategy.PLoS Genet. 2011 Jul;7(7):e1002178. doi: 10.1371/journal.pgen.1002178. Epub 2011 Jul 14.
• [25] Analysis of clinical characteristics and efficacy of chronic myeloid leukemia onset with extreme thrombocytosis in the era of tyrosine kinase inhibitors.Onco Targets Ther. 2017 Jul 17;10:3515-3520. doi: 10.2147/OTT.S142587. eCollection 2017.
• [26] HLA DPA1, DPB1 alleles and haplotypes contribute to the risk associated with type 1 diabetes: analysis of the type 1 diabetes genetics consortium families.Diabetes. 2010 Aug;59(8):2055-62. doi: 10.2337/db09-0680. Epub 2010 Apr 27.
• [27] Genome-wide association study identifies HLA-DP as a susceptibility gene for pediatric asthma in Asian populations.PLoS Genet. 2011 Jul;7(7):e1002170. doi: 10.1371/journal.pgen.1002170. Epub 2011 Jul 21.
• [28] Contribution of major histocompatibility complex genes to susceptibility and resistance in Helicobacter pylori related diseases.Eur J Gastroenterol Hepatol. 1999 Aug;11(8):875-80. doi: 10.1097/00042737-199908000-00011.
• [29] Distinct HLA associations by stroke subtype in children with sickle cell anemia.Blood. 2003 Apr 1;101(7):2865-9. doi: 10.1182/blood-2002-09-2791. Epub 2002 Nov 27.
• [30] Allergic and Nonallergic Asthma Have Distinct Phenotypic and Genotypic Features.Int Arch Allergy Immunol. 2017;172(3):150-160. doi: 10.1159/000458151. Epub 2017 Apr 6.
• [31] Genetic variants in five novel loci including CFB and CD40 predispose to chronic hepatitis B.Hepatology. 2015 Jul;62(1):118-28. doi: 10.1002/hep.27794. Epub 2015 Apr 28.
• [32] Investigation of HLA-DPA1 genotypes as predictors of inflammatory bowel disease in the German, South African, and South Korean populations.Int J Colorectal Dis. 2002 Jul;17(4):238-44. doi: 10.1007/s00384-001-0382-3. Epub 2001 Dec 21.
• [33] HLA typing using next-generation sequencing for Chinese juvenile- and adult-onset myasthenia gravis patients.J Clin Neurosci. 2019 Jan;59:179-184. doi: 10.1016/j.jocn.2018.10.077. Epub 2018 Oct 24.
• [34] Circulating and disseminated tumor cells from breast cancer patient-derived xenograft-bearing mice as a novel model to study metastasis.Breast Cancer Res. 2015 Jan 9;17(1):3. doi: 10.1186/s13058-014-0508-5.
• [35] Association of primary biliary cirrhosis with the allele HLA-DPB1*0301 in a German population.Hepatology. 1995 Feb;21(2):398-402. doi: 10.1002/hep.1840210221.
• [36] HLA-DP control of human Schistosoma haematobium infection.Am J Trop Med Hyg. 1998 Aug;59(2):302-6. doi: 10.4269/ajtmh.1998.59.302.
• [37] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [38] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [39] Comparison of the global gene expression profiles produced by methylparaben, n-butylparaben and 17beta-oestradiol in MCF7 human breast cancer cells. J Appl Toxicol. 2007 Jan-Feb;27(1):67-77. doi: 10.1002/jat.1200.
• [40] Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
• [41] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [42] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [43] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [44] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [45] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [46] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [47] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [48] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [49] Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
• [50] Systems pharmacological analysis of drugs inducing stevens-johnson syndrome and toxic epidermal necrolysis. Chem Res Toxicol. 2015 May 18;28(5):927-34. doi: 10.1021/tx5005248. Epub 2015 Apr 3.
• [51] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [52] Induction of class II major histocompatibility complex expression in human multiple myeloma cells by retinoid. Haematologica. 2007 Jan;92(1):115-20.
• [53] Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
• [54] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [55] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [56] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.