Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT91QASK)

DOT Name Adropin (ENHO)
Synonyms Energy homeostasis-associated protein
Gene Name ENHO
Related Disease
Acute myocardial infarction ( )
Advanced cancer ( )
Alcoholic cirrhosis of liver ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Atrial fibrillation ( )
Behcet disease ( )
Breast cancer ( )
Breast carcinoma ( )
Cardiac disease ( )
Cardiac failure ( )
Cardiovascular disease ( )
Chronic kidney disease ( )
Classic Hodgkin lymphoma ( )
Congestive heart failure ( )
Depression ( )
Diabetic retinopathy ( )
High blood pressure ( )
Huntington disease ( )
Hyperglycemia ( )
Hyperinsulinemia ( )
Liver cirrhosis ( )
Non-insulin dependent diabetes ( )
Obstructive sleep apnea ( )
Polycystic ovarian syndrome ( )
Proliferative diabetic retinopathy ( )
Rheumatoid arthritis ( )
Systemic lupus erythematosus ( )
Type-1/2 diabetes ( )
Vascular disease ( )
Hypertension, pregnancy-induced ( )
Knee osteoarthritis ( )
Osteoarthritis ( )
Prader-Willi syndrome ( )
Stroke ( )
Acute coronary syndrome ( )
Non-alcoholic fatty liver disease ( )
Chronic renal failure ( )
Coronary atherosclerosis ( )
Coronary heart disease ( )
End-stage renal disease ( )
Non-alcoholic steatohepatitis ( )
UniProt ID
ENHO_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKA
PPPQKPSHEGSYLLQP
Function Involved in the regulation of glucose homeostasis and lipid metabolism.
Tissue Specificity Expressed in liver and brain.

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute myocardial infarction DISE3HTG Strong Altered Expression [1]
Advanced cancer DISAT1Z9 Strong Biomarker [2]
Alcoholic cirrhosis of liver DISQ1WRT Strong Biomarker [3]
Arteriosclerosis DISK5QGC Strong Biomarker [4]
Atherosclerosis DISMN9J3 Strong Biomarker [4]
Atrial fibrillation DIS15W6U Strong Biomarker [5]
Behcet disease DISSYMBS Strong Altered Expression [6]
Breast cancer DIS7DPX1 Strong Biomarker [2]
Breast carcinoma DIS2UE88 Strong Biomarker [2]
Cardiac disease DISVO1I5 Strong Biomarker [7]
Cardiac failure DISDC067 Strong Biomarker [8]
Cardiovascular disease DIS2IQDX Strong Biomarker [9]
Chronic kidney disease DISW82R7 Strong Biomarker [10]
Classic Hodgkin lymphoma DISV1LU6 Strong Genetic Variation [11]
Congestive heart failure DIS32MEA Strong Biomarker [8]
Depression DIS3XJ69 Strong Biomarker [12]
Diabetic retinopathy DISHGUJM Strong Biomarker [13]
High blood pressure DISY2OHH Strong Biomarker [10]
Huntington disease DISQPLA4 Strong Genetic Variation [11]
Hyperglycemia DIS0BZB5 Strong Biomarker [14]
Hyperinsulinemia DISIDWT6 Strong Biomarker [15]
Liver cirrhosis DIS4G1GX Strong Biomarker [3]
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [13]
Obstructive sleep apnea DIS0SVD1 Strong Biomarker [16]
Polycystic ovarian syndrome DISZ2BNG Strong Biomarker [17]
Proliferative diabetic retinopathy DISQZ13G Strong Biomarker [13]
Rheumatoid arthritis DISTSB4J Strong Altered Expression [18]
Systemic lupus erythematosus DISI1SZ7 Strong Altered Expression [18]
Type-1/2 diabetes DISIUHAP Strong Biomarker [13]
Vascular disease DISVS67S Strong Altered Expression [6]
Hypertension, pregnancy-induced DISHNU25 moderate Altered Expression [19]
Knee osteoarthritis DISLSNBJ moderate Biomarker [20]
Osteoarthritis DIS05URM moderate Altered Expression [20]
Prader-Willi syndrome DISYWMLU moderate Biomarker [21]
Stroke DISX6UHX moderate Altered Expression [22]
Acute coronary syndrome DIS7DYEW Disputed Altered Expression [23]
Non-alcoholic fatty liver disease DISDG1NL Disputed Genetic Variation [23]
Chronic renal failure DISGG7K6 Limited Biomarker [24]
Coronary atherosclerosis DISKNDYU Limited Biomarker [23]
Coronary heart disease DIS5OIP1 Limited Biomarker [23]
End-stage renal disease DISXA7GG Limited Biomarker [24]
Non-alcoholic steatohepatitis DIST4788 Limited Biomarker [25]
------------------------------------------------------------------------------------
⏷ Show the Full List of 42 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Adropin (ENHO). [26]
Cocaine DMSOX7I Approved Cocaine decreases the expression of Adropin (ENHO). [27]
Heroin diacetylmorphine DMDBWHY Approved Heroin diacetylmorphine decreases the expression of Adropin (ENHO). [27]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Adropin (ENHO). [29]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Adropin (ENHO). [30]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Adropin (ENHO). [31]
ORG2058 DMH1M6N Investigative ORG2058 decreases the expression of Adropin (ENHO). [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Adropin (ENHO). [28]
------------------------------------------------------------------------------------

References

1 Association between serum adropin level and coronary artery disease: a systematic review and meta-analysis.Cardiovasc Diagn Ther. 2019 Feb;9(1):1-7. doi: 10.21037/cdt.2018.07.09.
2 Effects of Chronic and Intermittent Calorie Restriction on Adropin Levels in Breast Cancer.Nutr Cancer. 2017 Oct;69(7):1003-1010. doi: 10.1080/01635581.2017.1359314. Epub 2017 Sep 18.
3 Afamin and adropin in patients with alcohol-induced liver cirrhosis.Ann Agric Environ Med. 2018 Sep 25;25(3):527-531. doi: 10.26444/aaem/92650. Epub 2018 Jul 25.
4 Adropin Contributes to Anti-Atherosclerosis by Suppressing Monocyte-Endothelial Cell Adhesion and Smooth Muscle Cell Proliferation.Int J Mol Sci. 2018 Apr 26;19(5):1293. doi: 10.3390/ijms19051293.
5 Association of serum adropin with the presence of atrial fibrillation and atrial remodeling.J Clin Lab Anal. 2019 Feb;33(2):e22672. doi: 10.1002/jcla.22672. Epub 2018 Sep 21.
6 Serum adropin level and ENHO gene expression in systemic sclerosis.Clin Rheumatol. 2016 Jun;35(6):1535-40. doi: 10.1007/s10067-016-3266-1. Epub 2016 Apr 15.
7 Adropin regulates cardiac energy metabolism and improves cardiac function and efficiency.Metabolism. 2019 Sep;98:37-48. doi: 10.1016/j.metabol.2019.06.005. Epub 2019 Jun 14.
8 Adropin and Irisin in Patients with Cardiac Cachexia.Arq Bras Cardiol. 2018 Jul;111(1):39-47. doi: 10.5935/abc.20180109. Epub 2018 Jul 2.
9 A novel peptide adropin in cardiovascular diseases.Clin Chim Acta. 2016 Jan 30;453:107-13. doi: 10.1016/j.cca.2015.12.010. Epub 2015 Dec 10.
10 Adropin and irisin in arterial hypertension, diabetes mellitus and chronic kidney disease.Adv Clin Exp Med. 2019 Nov;28(11):1571-1575. doi: 10.17219/acem/104551.
11 Calcium-sensing receptor gene (CASR) polymorphisms and CASR transcript level concerning dyslipidemia in hemodialysis patients: a cross-sectional study.BMC Nephrol. 2019 Nov 27;20(1):436. doi: 10.1186/s12882-019-1619-0.
12 Alterations of irisin, adropin, preptin and BDNF concentrations in coronary heart disease patients comorbid with depression.Ann Transl Med. 2019 Jul;7(14):298. doi: 10.21037/atm.2019.05.77.
13 The association of serum and vitreous adropin concentrations with diabetic retinopathy.Ann Clin Biochem. 2019 Mar;56(2):253-258. doi: 10.1177/0004563218820359. Epub 2019 Feb 24.
14 Low plasma adropin concentrations increase risks of weight gain and metabolic dysregulation in response to a high-sugar diet in male nonhuman primates.J Biol Chem. 2019 Jun 21;294(25):9706-9719. doi: 10.1074/jbc.RA119.007528. Epub 2019 Apr 15.
15 Identification of adropin as a secreted factor linking dietary macronutrient intake with energy homeostasis and lipid metabolism.Cell Metab. 2008 Dec;8(6):468-81. doi: 10.1016/j.cmet.2008.10.011.
16 Adropin and Inflammation Biomarker Levels in Male Patients With Obstructive Sleep Apnea: A Link With Glucose Metabolism and Sleep Parameters.J Clin Sleep Med. 2018 Jul 15;14(7):1109-1118. doi: 10.5664/jcsm.7204.
17 Adropin in women with polycystic ovary syndrome.Endokrynol Pol. 2019;70(2):151-156. doi: 10.5603/EP.a2018.0092. Epub 2018 Nov 27.
18 ENHO gene expression and serum adropin level in rheumatoid arthritis and systemic lupus erythematosus.Adv Clin Exp Med. 2018 Dec;27(12):1637-1641. doi: 10.17219/acem/75944.
19 Negative association between serum adropin and hypertensive disorders complicating pregnancy.Hypertens Pregnancy. 2019 Nov;38(4):237-244. doi: 10.1080/10641955.2019.1657887. Epub 2019 Aug 23.
20 A novel biomarker in patients with knee osteoarthritis: adropin.Clin Rheumatol. 2018 Aug;37(8):2179-2186. doi: 10.1007/s10067-018-4052-z. Epub 2018 Mar 16.
21 Obestatin and adropin in Prader-Willi syndrome and nonsyndromic obesity: Associations with weight, BMI-z, and HOMA-IR.Pediatr Obes. 2019 May;14(5):e12493. doi: 10.1111/ijpo.12493. Epub 2018 Dec 27.
22 Adropin preserves the blood-brain barrier through a Notch1/Hes1 pathway after intracerebral hemorrhage in mice.J Neurochem. 2017 Dec;143(6):750-760. doi: 10.1111/jnc.14238. Epub 2017 Nov 17.
23 Adropin: Connection between Nonalcoholic Fatty Liver Disease and Coronary Artery Disease.Med Princ Pract. 2020;29(1):97. doi: 10.1159/000502039. Epub 2019 Jul 11.
24 Adropin and irisin: New biomarkers of cardiac status in patients with end-stage renal disease? A preliminary study.Adv Clin Exp Med. 2019 Mar;28(3):347-353. doi: 10.17219/acem/81538.
25 Adropin protects against liver injury in nonalcoholic steatohepatitis via the Nrf2 mediated antioxidant capacity.Redox Biol. 2019 Feb;21:101068. doi: 10.1016/j.redox.2018.101068. Epub 2018 Dec 6.
26 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
27 Distinctive profiles of gene expression in the human nucleus accumbens associated with cocaine and heroin abuse. Neuropsychopharmacology. 2006 Oct;31(10):2304-12. doi: 10.1038/sj.npp.1301089. Epub 2006 May 3.
28 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
29 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
30 Characterization of the Molecular Alterations Induced by the Prolonged Exposure of Normal Colon Mucosa and Colon Cancer Cells to Low-Dose Bisphenol A. Int J Mol Sci. 2022 Oct 1;23(19):11620. doi: 10.3390/ijms231911620.
31 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
32 The antiproliferative effects of progestins in T47D breast cancer cells are tempered by progestin induction of the ETS transcription factor Elf5. Mol Endocrinol. 2010 Jul;24(7):1380-92. doi: 10.1210/me.2009-0516. Epub 2010 Jun 2.