Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9TTJ41)

DOT Name CD44 antigen (CD44)
Synonyms
CDw44; Epican; Extracellular matrix receptor III; ECMR-III; GP90 lymphocyte homing/adhesion receptor; HUTCH-I; Heparan sulfate proteoglycan; Hermes antigen; Hyaluronate receptor; Phagocytic glycoprotein 1; PGP-1; Phagocytic glycoprotein I; PGP-I; CD antigen CD44
Gene Name CD44
UniProt ID
CD44_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1POZ; 1UUH; 2I83; 4PZ3; 4PZ4; 6TXS
Pfam ID
PF00193
Sequence
MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSS
GSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQE
TWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDD
EDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWN
PEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS
HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSIT
LQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDV
TGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNR
SLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLAL
ALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSET
PDQFMTADETRNLQNVDMKIGV
Function
Cell-surface receptor that plays a role in cell-cell interactions, cell adhesion and migration, helping them to sense and respond to changes in the tissue microenvironment. Participates thereby in a wide variety of cellular functions including the activation, recirculation and homing of T-lymphocytes, hematopoiesis, inflammation and response to bacterial infection. Engages, through its ectodomain, extracellular matrix components such as hyaluronan/HA, collagen, growth factors, cytokines or proteases and serves as a platform for signal transduction by assembling, via its cytoplasmic domain, protein complexes containing receptor kinases and membrane proteases. Such effectors include PKN2, the RhoGTPases RAC1 and RHOA, Rho-kinases and phospholipase C that coordinate signaling pathways promoting calcium mobilization and actin-mediated cytoskeleton reorganization essential for cell migration and adhesion.
Tissue Specificity
Detected in fibroblasts and urine (at protein level) . Detected in placenta (at protein level) . Isoform 10 (epithelial isoform) is expressed by cells of epithelium and highly expressed by carcinomas. Expression is repressed in neuroblastoma cells.
KEGG Pathway
ECM-receptor interaction (hsa04512 )
Hematopoietic cell lineage (hsa04640 )
Shigellosis (hsa05131 )
Epstein-Barr virus infection (hsa05169 )
Proteoglycans in cancer (hsa05205 )
MicroR.s in cancer (hsa05206 )
Reactome Pathway
Cell surface interactions at the vascular wall (R-HSA-202733 )
Integrin cell surface interactions (R-HSA-216083 )
Hyaluronan uptake and degradation (R-HSA-2160916 )
Neutrophil degranulation (R-HSA-6798695 )
Interferon gamma signaling (R-HSA-877300 )
Degradation of the extracellular matrix (R-HSA-1474228 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 6 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved CD44 antigen (CD44) increases the response to substance of Acetaminophen. [60]
Cisplatin DMRHGI9 Approved CD44 antigen (CD44) decreases the response to substance of Cisplatin. [61]
Temozolomide DMKECZD Approved CD44 antigen (CD44) affects the response to substance of Temozolomide. [62]
Etoposide DMNH3PG Approved CD44 antigen (CD44) affects the response to substance of Etoposide. [63]
DTI-015 DMXZRW0 Approved CD44 antigen (CD44) affects the response to substance of DTI-015. [62]
Chlorothiazide DMLHESP Approved CD44 antigen (CD44) increases the Metabolic disorder ADR of Chlorothiazide. [64]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of CD44 antigen (CD44). [1]
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of CD44 antigen (CD44). [51]
------------------------------------------------------------------------------------
65 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of CD44 antigen (CD44). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of CD44 antigen (CD44). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of CD44 antigen (CD44). [4]
Estradiol DMUNTE3 Approved Estradiol increases the expression of CD44 antigen (CD44). [5]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of CD44 antigen (CD44). [6]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of CD44 antigen (CD44). [7]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of CD44 antigen (CD44). [8]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of CD44 antigen (CD44). [9]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of CD44 antigen (CD44). [10]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of CD44 antigen (CD44). [11]
Decitabine DMQL8XJ Approved Decitabine affects the expression of CD44 antigen (CD44). [12]
Marinol DM70IK5 Approved Marinol increases the expression of CD44 antigen (CD44). [13]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of CD44 antigen (CD44). [14]
Selenium DM25CGV Approved Selenium increases the expression of CD44 antigen (CD44). [15]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of CD44 antigen (CD44). [16]
Progesterone DMUY35B Approved Progesterone decreases the expression of CD44 antigen (CD44). [17]
Panobinostat DM58WKG Approved Panobinostat increases the expression of CD44 antigen (CD44). [18]
Fulvestrant DM0YZC6 Approved Fulvestrant decreases the expression of CD44 antigen (CD44). [19]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of CD44 antigen (CD44). [20]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of CD44 antigen (CD44). [21]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the expression of CD44 antigen (CD44). [19]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of CD44 antigen (CD44). [22]
Aspirin DM672AH Approved Aspirin decreases the expression of CD44 antigen (CD44). [23]
Piroxicam DMTK234 Approved Piroxicam increases the expression of CD44 antigen (CD44). [24]
Cocaine DMSOX7I Approved Cocaine decreases the expression of CD44 antigen (CD44). [25]
Simvastatin DM30SGU Approved Simvastatin decreases the expression of CD44 antigen (CD44). [26]
Gemcitabine DMSE3I7 Approved Gemcitabine affects the expression of CD44 antigen (CD44). [27]
Lovastatin DM9OZWQ Approved Lovastatin decreases the expression of CD44 antigen (CD44). [26]
Mestranol DMG3F94 Approved Mestranol increases the expression of CD44 antigen (CD44). [19]
Crizotinib DM4F29C Approved Crizotinib decreases the expression of CD44 antigen (CD44). [28]
Ciprofloxacin XR DM2NLS9 Approved Ciprofloxacin XR increases the expression of CD44 antigen (CD44). [29]
Etodolac DM6WJO9 Approved Etodolac decreases the expression of CD44 antigen (CD44). [30]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of CD44 antigen (CD44). [18]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of CD44 antigen (CD44). [31]
Tamibarotene DM3G74J Phase 3 Tamibarotene decreases the expression of CD44 antigen (CD44). [32]
Curcumin DMQPH29 Phase 3 Curcumin increases the expression of CD44 antigen (CD44). [33]
Rigosertib DMOSTXF Phase 3 Rigosertib increases the expression of CD44 antigen (CD44). [34]
Chlorpromazine DMBGZI3 Phase 3 Trial Chlorpromazine decreases the expression of CD44 antigen (CD44). [35]
Napabucasin DMDZ6Q3 Phase 3 Napabucasin decreases the expression of CD44 antigen (CD44). [36]
Guaiacol DMN4E7T Phase 3 Guaiacol increases the expression of CD44 antigen (CD44). [37]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of CD44 antigen (CD44). [38]
Thymoquinone DMVDTR2 Phase 2/3 Thymoquinone decreases the expression of CD44 antigen (CD44). [39]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of CD44 antigen (CD44). [40]
Afimoxifene DMFORDT Phase 2 Afimoxifene increases the expression of CD44 antigen (CD44). [41]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of CD44 antigen (CD44). [42]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of CD44 antigen (CD44). [43]
Eugenol DM7US1H Patented Eugenol decreases the expression of CD44 antigen (CD44). [44]
HEXESTROL DM9AGWQ Withdrawn from market HEXESTROL increases the expression of CD44 antigen (CD44). [19]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of CD44 antigen (CD44). [45]
Calphostin C DM9X2D0 Terminated Calphostin C decreases the expression of CD44 antigen (CD44). [46]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of CD44 antigen (CD44). [47]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of CD44 antigen (CD44). [48]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of CD44 antigen (CD44). [49]
Milchsaure DM462BT Investigative Milchsaure increases the expression of CD44 antigen (CD44). [50]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of CD44 antigen (CD44). [5]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of CD44 antigen (CD44). [52]
Glyphosate DM0AFY7 Investigative Glyphosate increases the expression of CD44 antigen (CD44). [53]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of CD44 antigen (CD44). [54]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of CD44 antigen (CD44). [55]
Lithium chloride DMHYLQ2 Investigative Lithium chloride increases the expression of CD44 antigen (CD44). [56]
Okadaic acid DM47CO1 Investigative Okadaic acid increases the expression of CD44 antigen (CD44). [57]
Kaempferol DMHEMUB Investigative Kaempferol decreases the expression of CD44 antigen (CD44). [27]
Chlorogenic acid DM2Y3P4 Investigative Chlorogenic acid increases the expression of CD44 antigen (CD44). [37]
3,7,3',4'-TETRAHYDROXYFLAVONE DMES906 Investigative 3,7,3',4'-TETRAHYDROXYFLAVONE decreases the expression of CD44 antigen (CD44). [58]
Oxalic Acid DMLN2GQ Investigative Oxalic Acid increases the expression of CD44 antigen (CD44). [59]
------------------------------------------------------------------------------------
⏷ Show the Full List of 65 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
6 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7 Gene expression profiles in peripheral lymphocytes by arsenic exposure and skin lesion status in a Bangladeshi population. Cancer Epidemiol Biomarkers Prev. 2006 Jul;15(7):1367-75. doi: 10.1158/1055-9965.EPI-06-0106.
8 Thermochemotherapy effect of nanosized As2O3/Fe3O4 complex on experimental mouse tumors and its influence on the expression of CD44v6, VEGF-C and MMP-9. BMC Biotechnol. 2009 Oct 5;9:84. doi: 10.1186/1472-6750-9-84.
9 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
10 Chemoprevention of chemically-induced mammary and colon carcinogenesis by 1alpha-hydroxyvitamin D5. J Steroid Biochem Mol Biol. 2005 Oct;97(1-2):129-36. doi: 10.1016/j.jsbmb.2005.06.008. Epub 2005 Jul 26.
11 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
12 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
13 Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
14 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
15 Promotion of the articular cartilage proteoglycan degradation by T-2 toxin and selenium protective effect. J Zhejiang Univ Sci B. 2008 Jan;9(1):22-33. doi: 10.1631/jzus.B071322.
16 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
17 Effect of ovarian steroids on gene expression profile in human uterine microvascular endothelial cells. Fertil Steril. 2009 Aug;92(2):709-21.
18 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
19 Moving toward integrating gene expression profiling into high-throughput testing: a gene expression biomarker accurately predicts estrogen receptor alpha modulation in a microarray compendium. Toxicol Sci. 2016 May;151(1):88-103.
20 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
21 Cannabidiol Modulates the Immunophenotype and Inhibits the Activation of the Inflammasome in Human Gingival Mesenchymal Stem Cells. Front Physiol. 2016 Nov 24;7:559. doi: 10.3389/fphys.2016.00559. eCollection 2016.
22 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
23 Effect of aspirin on the Wnt/beta-catenin pathway is mediated via protein phosphatase 2A. Oncogene. 2006 Oct 19;25(49):6447-56. doi: 10.1038/sj.onc.1209658. Epub 2006 Jul 31.
24 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
25 Gene expression in human hippocampus from cocaine abusers identifies genes which regulate extracellular matrix remodeling. PLoS One. 2007 Nov 14;2(11):e1187. doi: 10.1371/journal.pone.0001187.
26 Simvastatin prevents skeletal metastasis of breast cancer by an antagonistic interplay between p53 and CD44. J Biol Chem. 2011 Apr 1;286(13):11314-27. doi: 10.1074/jbc.M110.193714. Epub 2011 Jan 3.
27 Deregulation of the CD44-NANOG-MDR1 associated chemoresistance pathways of breast cancer stem cells potentiates the anti-cancer effect of Kaempferol in synergism with Verapamil. Toxicol Appl Pharmacol. 2022 Feb 15;437:115887. doi: 10.1016/j.taap.2022.115887. Epub 2022 Jan 19.
28 Enhancement of the antiproliferative activity of gemcitabine by modulation of c-Met pathway in pancreatic cancer. Curr Pharm Des. 2013;19(5):940-50.
29 Ciprofloxacin mediates cancer stem cell phenotypes in lung cancer cells through caveolin-1-dependent mechanism. Chem Biol Interact. 2016 Apr 25;250:1-11.
30 Etodolac induces apoptosis and inhibits cell adhesion to bone marrow stromal cells in human myeloma cells. Leuk Res. 2006 Feb;30(2):123-35. doi: 10.1016/j.leukres.2005.06.009. Epub 2005 Jul 25.
31 Impairment of tumor-initiating stem-like property and reversal of epithelial-mesenchymal transdifferentiation in head and neck cancer by resveratrol treatment. Mol Nutr Food Res. 2012 Aug;56(8):1247-58. doi: 10.1002/mnfr.201200150. Epub 2012 Jun 13.
32 Induction of class II major histocompatibility complex expression in human multiple myeloma cells by retinoid. Haematologica. 2007 Jan;92(1):115-20.
33 Gene expression profiling identifies activating transcription factor 3 as a novel contributor to the proapoptotic effect of curcumin. Mol Cancer Ther. 2005 Feb;4(2):233-41.
34 ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
35 The antipsychotic chlorpromazine suppresses YAP signaling, stemness properties, and drug resistance in breast cancer cells. Chem Biol Interact. 2019 Apr 1;302:28-35. doi: 10.1016/j.cbi.2019.01.033. Epub 2019 Jan 28.
36 Suppression of cancer relapse and metastasis by inhibiting cancer stemness. Proc Natl Acad Sci U S A. 2015 Feb 10;112(6):1839-44. doi: 10.1073/pnas.1424171112. Epub 2015 Jan 20.
37 Examining the genomic influence of skin antioxidants in vitro. Mediators Inflamm. 2010;2010.
38 Changes in gene expressions elicited by physiological concentrations of genistein on human endometrial cancer cells. Mol Carcinog. 2006 Oct;45(10):752-63.
39 Thymoquinone suppresses the proliferation of renal cell carcinoma cells via reactive oxygen species-induced apoptosis and reduces cell stemness. Environ Toxicol. 2019 Nov;34(11):1208-1220. doi: 10.1002/tox.22822. Epub 2019 Jul 12.
40 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
41 Gene expression preferentially regulated by tamoxifen in breast cancer cells and correlations with clinical outcome. Cancer Res. 2006 Jul 15;66(14):7334-40.
42 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
43 The BET bromodomain inhibitor JQ1 suppresses growth of pancreatic ductal adenocarcinoma in patient-derived xenograft models. Oncogene. 2016 Feb 18;35(7):833-45.
44 Eugenol restricts Cancer Stem Cell population by degradation of -catenin via N-terminal Ser37 phosphorylation-an in vivo and in vitro experimental evaluation. Chem Biol Interact. 2020 Jan 25;316:108938. doi: 10.1016/j.cbi.2020.108938. Epub 2020 Jan 8.
45 Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
46 Targeting the beta-catenin/TCF transcriptional complex in the treatment of multiple myeloma. Proc Natl Acad Sci U S A. 2007 May 1;104(18):7516-21. doi: 10.1073/pnas.0610299104. Epub 2007 Apr 23.
47 Epigenetic influences of low-dose bisphenol A in primary human breast epithelial cells. Toxicol Appl Pharmacol. 2010 Oct 15;248(2):111-21.
48 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
49 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
50 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
51 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
52 Deguelin inhibits the migration and invasion of lung cancer A549 and H460 cells via regulating actin cytoskeleton rearrangement. Int J Clin Exp Pathol. 2015 Dec 1;8(12):15582-90. eCollection 2015.
53 Evaluation of estrogen receptor alpha activation by glyphosate-based herbicide constituents. Food Chem Toxicol. 2017 Oct;108(Pt A):30-42.
54 Cancer stem-like cells accumulated in nickel-induced malignant transformation. Toxicol Sci. 2016 Jun;151(2):376-87.
55 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
56 Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
57 Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
58 Fisetin suppresses migration, invasion and stem-cell-like phenotype of human non-small cell lung carcinoma cells via attenuation of epithelial to mesenchymal transition. Chem Biol Interact. 2019 Apr 25;303:14-21. doi: 10.1016/j.cbi.2019.02.020. Epub 2019 Feb 22.
59 Butyric acid inhibits oxidative stress and inflammation injury in calcium oxalate nephrolithiasis by targeting CYP2C9. Food Chem Toxicol. 2023 Aug;178:113925. doi: 10.1016/j.fct.2023.113925. Epub 2023 Jul 4.
60 Mouse population-guided resequencing reveals that variants in CD44 contribute to acetaminophen-induced liver injury in humans. Genome Res. 2009 Sep;19(9):1507-15. doi: 10.1101/gr.090241.108. Epub 2009 May 5.
61 CD44-SLC1A2 gene fusions in gastric cancer. Sci Transl Med. 2011 Apr 6;3(77):77ra30. doi: 10.1126/scitranslmed.3001423.
62 Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.
63 CD44 promotes resistance to apoptosis in human colon cancer cells. Exp Mol Pathol. 2004 Aug;77(1):18-25. doi: 10.1016/j.yexmp.2004.03.002.
64 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans. Pharmacogenomics J. 2014 Feb;14(1):35-40. doi: 10.1038/tpj.2013.3. Epub 2013 Feb 12.