Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAV1OCR)

• DOT Name: Metallothionein-1G (MT1G)
• Synonyms: MT-1G; Metallothionein-1K; MT-1K; Metallothionein-IG; MT-IG
• Gene Name: MT1G
• Related Disease:
  Esophageal cancer
  Neoplasm of esophagus
  Amyotrophic lateral sclerosis type 1
  Androgen insensitivity syndrome
  Breast carcinoma
  Classic Hodgkin lymphoma
  Colonic neoplasm
  Colorectal carcinoma
  Creutzfeldt Jacob disease
  Esophageal squamous cell carcinoma
  Glioma
  Graves disease
  Hepatocellular carcinoma
  Huntington disease
  Laryngeal carcinoma
  Laryngeal squamous cell carcinoma
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Lymphosarcoma
  Malignant pleural mesothelioma
  Nephritis
  Osteoporosis
  Thyroid gland papillary carcinoma
  Thyroid tumor
  Thyroid cancer
  Thyroid gland carcinoma
  Non-small-cell lung cancer
  Prostate cancer
  Prostate carcinoma
  Breast cancer
  Breast neoplasm
  Clear cell renal carcinoma
  Glaucoma/ocular hypertension
  Lupus nephritis
  Non-insulin dependent diabetes
  Renal cell carcinoma
  Stroke
  Thyroid gland follicular carcinoma
• UniProt ID: MT1G_HUMAN
• Pfam ID: PF00131
• Sequence:
  MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSC
  CA
• Function: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
• KEGG Pathway: Mineral absorption (hsa04978)
• Reactome Pathway: Metallothioneins bind metals (R-HSA-5661231)

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Esophageal cancer	DISGB2VN	Definitive	Biomarker	[1]
Neoplasm of esophagus	DISOLKAQ	Definitive	Biomarker	[1]
Amyotrophic lateral sclerosis type 1	DIS5A2M0	Strong	Biomarker	[2]
Androgen insensitivity syndrome	DISUZBBO	Strong	Altered Expression	[3]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Genetic Variation	[5]
Colonic neoplasm	DISSZ04P	Strong	Posttranslational Modification	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[7]
Creutzfeldt Jacob disease	DISCB6RX	Strong	Biomarker	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Posttranslational Modification	[9]
Glioma	DIS5RPEH	Strong	Biomarker	[10]
Graves disease	DISU4KOQ	Strong	Biomarker	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[12]
Huntington disease	DISQPLA4	Strong	Altered Expression	[13]
Laryngeal carcinoma	DISNHCIV	Strong	Biomarker	[14]
Laryngeal squamous cell carcinoma	DIS9UUVF	Strong	Biomarker	[14]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[15]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[16]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[16]
Lymphosarcoma	DISGYV3F	Strong	Posttranslational Modification	[17]
Malignant pleural mesothelioma	DIST2R60	Strong	Biomarker	[18]
Nephritis	DISQZQ70	Strong	Altered Expression	[19]
Osteoporosis	DISF2JE0	Strong	Biomarker	[20]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Biomarker	[21]
Thyroid tumor	DISLVKMD	Strong	Altered Expression	[22]
Thyroid cancer	DIS3VLDH	moderate	Altered Expression	[22]
Thyroid gland carcinoma	DISMNGZ0	moderate	Altered Expression	[22]
Non-small-cell lung cancer	DIS5Y6R9	Disputed	Altered Expression	[23]
Prostate cancer	DISF190Y	Disputed	Altered Expression	[24]
Prostate carcinoma	DISMJPLE	Disputed	Altered Expression	[24]
Breast cancer	DIS7DPX1	Limited	Biomarker	[4]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[25]
Clear cell renal carcinoma	DISBXRFJ	Limited	Altered Expression	[26]
Glaucoma/ocular hypertension	DISLBXBY	Limited	Genetic Variation	[27]
Lupus nephritis	DISCVGPZ	Limited	Altered Expression	[19]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Altered Expression	[28]
Renal cell carcinoma	DISQZ2X8	Limited	Altered Expression	[26]
Stroke	DISX6UHX	Limited	Biomarker	[29]
Thyroid gland follicular carcinoma	DISFK2QT	Limited	Altered Expression	[30]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Metallothionein-1G (MT1G) decreases the response to substance of Cisplatin.	[69]

42 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Metallothionein-1G (MT1G).	[31]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Metallothionein-1G (MT1G).	[32]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Metallothionein-1G (MT1G).	[33]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Metallothionein-1G (MT1G).	[34]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Metallothionein-1G (MT1G).	[35]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Metallothionein-1G (MT1G).	[36]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Metallothionein-1G (MT1G).	[37]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Metallothionein-1G (MT1G).	[38]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Metallothionein-1G (MT1G).	[39]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Metallothionein-1G (MT1G).	[40]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Metallothionein-1G (MT1G).	[41]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Metallothionein-1G (MT1G).	[42]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Metallothionein-1G (MT1G).	[40]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Metallothionein-1G (MT1G).	[43]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Metallothionein-1G (MT1G).	[44]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Metallothionein-1G (MT1G).	[45]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Metallothionein-1G (MT1G).	[46]
Gamolenic acid	DMQN30Z	Approved	Gamolenic acid increases the expression of Metallothionein-1G (MT1G).	[47]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Metallothionein-1G (MT1G).	[48]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Metallothionein-1G (MT1G).	[49]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Metallothionein-1G (MT1G).	[50]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Metallothionein-1G (MT1G).	[51]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Metallothionein-1G (MT1G).	[52]
Disulfiram	DMCL2OK	Phase 2 Trial	Disulfiram increases the expression of Metallothionein-1G (MT1G).	[53]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Metallothionein-1G (MT1G).	[55]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide affects the expression of Metallothionein-1G (MT1G).	[56]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Metallothionein-1G (MT1G).	[33]
Terfenadine	DM4KLPT	Withdrawn from market	Terfenadine increases the expression of Metallothionein-1G (MT1G).	[57]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Metallothionein-1G (MT1G).	[58]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Metallothionein-1G (MT1G).	[59]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Metallothionein-1G (MT1G).	[60]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Metallothionein-1G (MT1G).	[61]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Metallothionein-1G (MT1G).	[62]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Metallothionein-1G (MT1G).	[63]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Metallothionein-1G (MT1G).	[57]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Metallothionein-1G (MT1G).	[64]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride increases the expression of Metallothionein-1G (MT1G).	[65]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Metallothionein-1G (MT1G).	[37]
Okadaic acid	DM47CO1	Investigative	Okadaic acid increases the expression of Metallothionein-1G (MT1G).	[66]
Lead acetate	DML0GZ2	Investigative	Lead acetate increases the expression of Metallothionein-1G (MT1G).	[67]
NSC-1771	DMNXDGQ	Investigative	NSC-1771 increases the expression of Metallothionein-1G (MT1G).	[57]
Pyrrolidine dithiocarbamate	DM5ZAS6	Investigative	Pyrrolidine dithiocarbamate increases the expression of Metallothionein-1G (MT1G).	[68]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Metallothionein-1G (MT1G).	[54]

References

• [1] Discovery of deregulation of zinc homeostasis and its associated genes in esophageal squamous cell carcinoma using cDNA microarray.Int J Cancer. 2007 Jan 15;120(2):230-42. doi: 10.1002/ijc.22246.
• [2] Reduction of metallothioneins promotes the disease expression of familial amyotrophic lateral sclerosis mice in a dose-dependent manner.Eur J Neurosci. 2001 Apr;13(7):1363-70. doi: 10.1046/j.0953-816x.2001.01512.x.
• [3] Abnormal melatonin receptor 1B expression in osteoblasts from girls with adolescent idiopathic scoliosis.J Pineal Res. 2011 May;50(4):395-402. doi: 10.1111/j.1600-079X.2011.00857.x. Epub 2011 Feb 24.
• [4] A case-control study of Metallothionein-1 expression in breast cancer and breast fibroadenoma.Sci Rep. 2019 May 15;9(1):7407. doi: 10.1038/s41598-019-43565-0.
• [5] A novel MspI PCR-RFLP in the human cytosine 5-methyltransferase gene: lack of relevance for malignant lymphoproliferative disease and breast cancer.Hum Hered. 1998 Jul-Aug;48(4):226-9. doi: 10.1159/000022805.
• [6] Induction of apoptosis by wild-type p53 in a human colon tumor-derived cell line.Proc Natl Acad Sci U S A. 1992 May 15;89(10):4495-9. doi: 10.1073/pnas.89.10.4495.
• [7] Metallothionein 1G promotes the differentiation of HT-29 human colorectal cancer cells.Oncol Rep. 2017 May;37(5):2633-2651. doi: 10.3892/or.2017.5547. Epub 2017 Apr 3.
• [8] Differential expression of metallothioneins in human prion diseases.Dement Geriatr Cogn Disord. 2000 Sep-Oct;11(5):251-62. doi: 10.1159/000017247.
• [9] p16, MGMT, RARbeta2, CLDN3, CRBP and MT1G gene methylation in esophageal squamous cell carcinoma and its precursor lesions.Oncol Rep. 2006 Jun;15(6):1591-7.
• [10] The melatonin-MT1 receptor axis modulates tumor growth in PTEN-mutated gliomas.Biochem Biophys Res Commun. 2018 Feb 19;496(4):1322-1330. doi: 10.1016/j.bbrc.2018.02.010.
• [11] Expression of Metallothionein I/II and Ki-67 Antigen in Graves' Disease.Anticancer Res. 2018 Dec;38(12):6847-6853. doi: 10.21873/anticanres.13059.
• [12] MT1G serves as a tumor suppressor in hepatocellular carcinoma by interacting with p53.Oncogenesis. 2019 Nov 15;8(12):67. doi: 10.1038/s41389-019-0176-5.
• [13] The melatonin MT1 receptor axis modulates mutant Huntingtin-mediated toxicity.J Neurosci. 2011 Oct 12;31(41):14496-507. doi: 10.1523/JNEUROSCI.3059-11.2011.
• [14] Potential biomarkers for head and neck squamous cell carcinoma.Laryngoscope. 2003 Mar;113(3):393-400. doi: 10.1097/00005537-200303000-00001.
• [15] Promoter methylation profiles between human lung adenocarcinoma multidrug resistant A549/cisplatin (A549/DDP) cells and its progenitor A549 cells.Biol Pharm Bull. 2013;36(8):1310-6. doi: 10.1248/bpb.b13-00153.
• [16] Impact of metallothionein gene polymorphisms on the risk of lung cancer in a Japanese population.Mol Carcinog. 2015 Jun;54 Suppl 1:E122-8. doi: 10.1002/mc.22198. Epub 2014 Aug 30.
• [17] Physical and functional interaction of DNA methyltransferase 3A with Mbd3 and Brg1 in mouse lymphosarcoma cells.Cancer Res. 2005 Dec 1;65(23):10891-900. doi: 10.1158/0008-5472.CAN-05-1455.
• [18] Immunohistochemically detectable metallothionein expression in malignant pleural mesotheliomas is strongly associated with early failure to platin-based chemotherapy.Oncotarget. 2018 Apr 27;9(32):22254-22268. doi: 10.18632/oncotarget.24962. eCollection 2018 Apr 27.
• [19] The renal metallothionein expression profile is altered in human lupus nephritis.Arthritis Res Ther. 2008;10(4):R76. doi: 10.1186/ar2450. Epub 2008 Jul 6.
• [20] A microarray based identification of osteoporosis-related genes in primary culture of human osteoblasts.Bone. 2010 Jan;46(1):72-80. doi: 10.1016/j.bone.2009.09.015. Epub 2009 Sep 23.
• [21] Metallothionein Isoform Expression in Benign and Malignant Thyroid Lesions.Anticancer Res. 2017 Sep;37(9):5179-5185. doi: 10.21873/anticanres.11940.
• [22] Metallothionein 1G functions as a tumor suppressor in thyroid cancer through modulating the PI3K/Akt signaling pathway.BMC Cancer. 2013 Oct 8;13:462. doi: 10.1186/1471-2407-13-462.
• [23] Metallothionein 1F and 2A overexpression predicts poor outcome of non-small cell lung cancer patients.Exp Mol Pathol. 2013 Feb;94(1):301-8. doi: 10.1016/j.yexmp.2012.10.006. Epub 2012 Oct 9.
• [24] Melatonin MT1 receptor-induced transcriptional up-regulation of p27(Kip1) in prostate cancer antiproliferation is mediated via inhibition of constitutively active nuclear factor kappa B (NF-B): potential implications on prostate cancer chemoprevention and therapy.J Pineal Res. 2013 Jan;54(1):69-79. doi: 10.1111/j.1600-079X.2012.01026.x. Epub 2012 Aug 1.
• [25] Immunohistochemical Expression of Melatonin Receptor MT1 and Glucose Transporter GLUT1 in Human Breast Cancer.Anticancer Agents Med Chem. 2018;18(15):2110-2116. doi: 10.2174/1871520618666181025125532.
• [26] DNA methylation of metallothionein genes is associated with the clinical features of renal cell carcinoma.Oncol Rep. 2019 Jun;41(6):3535-3544. doi: 10.3892/or.2019.7109. Epub 2019 Apr 10.
• [27] Variations in the myocilin gene in patients with open-angle glaucoma.Arch Ophthalmol. 2002 Sep;120(9):1189-97. doi: 10.1001/archopht.120.9.1189.
• [28] Metallothionein-mediated antioxidant defense system and its response to exercise training are impaired in human type 2 diabetes.Diabetes. 2005 Nov;54(11):3089-94. doi: 10.2337/diabetes.54.11.3089.
• [29] Metallothionein I as a direct link between therapeutic hematopoietic stem/progenitor cells and cerebral protection in stroke.FASEB J. 2018 May;32(5):2381-2394. doi: 10.1096/fj.201700746R. Epub 2017 Dec 21.
• [30] A molecular expression signature distinguishing follicular lesions in thyroid carcinoma using preamplification RT-PCR in archival samples.Mod Pathol. 2007 Oct;20(10):1095-102. doi: 10.1038/modpathol.3800943. Epub 2007 Jul 27.
• [31] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [32] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [33] Gene expression changes associated with cytotoxicity identified using cDNA arrays. Funct Integr Genomics. 2000 Sep;1(2):114-26.
• [34] Alteration of genomic responses to doxorubicin and prevention of MDR in breast cancer cells by a polymer excipient: pluronic P85. Mol Pharm. 2006 Mar-Apr;3(2):113-23.
• [35] Extremely low copper concentrations affect gene expression profiles of human prostate epithelial cell lines. Chem Biol Interact. 2010 Oct 6;188(1):214-9.
• [36] Human drug metabolism genes in parathion-and estrogen-treated breast cells. Int J Mol Med. 2007 Dec;20(6):875-81.
• [37] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [38] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [39] Changes in gene expression profiles of multiple myeloma cells induced by arsenic trioxide (ATO): possible mechanisms to explain ATO resistance in vivo. Br J Haematol. 2005 Mar;128(5):636-44.
• [40] Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
• [41] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [42] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [43] Glucocorticoids inhibit cell death in ovarian cancer and up-regulate caspase inhibitor cIAP2. Clin Cancer Res. 2005 Sep 1;11(17):6325-32. doi: 10.1158/1078-0432.CCR-05-0182.
• [44] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [45] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [46] Motexafin gadolinium disrupts zinc metabolism in human cancer cell lines. Cancer Res. 2005 May 1;65(9):3837-45.
• [47] Antineoplastic effects of gamma linolenic Acid on hepatocellular carcinoma cell lines. J Clin Biochem Nutr. 2010 Jul;47(1):81-90.
• [48] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [49] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [50] Application of the adverse outcome pathway concept for investigating developmental neurotoxicity potential of Chinese herbal medicines by using human neural progenitor cells in vitro. Cell Biol Toxicol. 2023 Feb;39(1):319-343. doi: 10.1007/s10565-022-09730-4. Epub 2022 Jun 15.
• [51] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [52] Estrogenic GPR30 signalling induces proliferation and migration of breast cancer cells through CTGF. EMBO J. 2009 Mar 4;28(5):523-32.
• [53] High-throughput cell-based screening of 4910 known drugs and drug-like small molecules identifies disulfiram as an inhibitor of prostate cancer cell growth. Clin Cancer Res. 2009 Oct 1;15(19):6070-8.
• [54] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [55] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [56] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [57] The MT1G Gene in LUHMES Neurons Is a Sensitive Biomarker of Neurotoxicity. Neurotox Res. 2020 Dec;38(4):967-978. doi: 10.1007/s12640-020-00272-3. Epub 2020 Sep 1.
• [58] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [59] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [60] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [61] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [62] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [63] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [64] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [65] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
• [66] Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
• [67] Analysis of lead toxicity in human cells. BMC Genomics. 2012 Jul 27;13:344.
• [68] Effects of a redox-active agent on lymphocyte activation and early gene expression patterns. Free Radic Biol Med. 2004 Nov 15;37(10):1550-63.
• [69] Combating the drug resistance of cisplatin using a platinum prodrug based delivery system. Angew Chem Int Ed Engl. 2012 Jul 2;51(27):6742-7. doi: 10.1002/anie.201201562. Epub 2012 May 25.