Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDD8OI7)

• DOT Name: Annexin A3 (ANXA3)
• Synonyms: 35-alpha calcimedin; Annexin III; Annexin-3; Inositol 1,2-cyclic phosphate 2-phosphohydrolase; Lipocortin III; Placental anticoagulant protein III; PAP-III
• Gene Name: ANXA3
• Related Disease:
  Bone osteosarcoma
  Osteosarcoma
  Acute myelogenous leukaemia
  Acute myocardial infarction
  Adenoma
  Advanced cancer
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Endometrial carcinoma
  Fibrosarcoma
  Gastric cancer
  Glaucoma/ocular hypertension
  Graves disease
  Hepatocellular carcinoma
  Huntington disease
  Liver cancer
  Lung cancer
  Lung carcinoma
  Neoplasm
  Neuralgia
  Promyelocytic leukaemia
  Prostate cancer
  Prostate neoplasm
  Schizophrenia
  Stomach cancer
  Triple negative breast cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Prostate carcinoma
  Colorectal carcinoma
  Epithelial ovarian cancer
  Human papillomavirus infection
  Metastatic malignant neoplasm
  Ovarian cancer
  Ovarian neoplasm
  Rheumatoid arthritis
  Systemic lupus erythematosus
• UniProt ID: ANXA3_HUMAN
• PDB ID: 1AII; 1AXN
• Pfam ID: PF00191
• Sequence:
  MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEY
  QAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTR
  TSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQ
  ILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLL
  LAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLY
  SAIKSDTSGDYEITLLKICGGDD
• Function: Inhibitor of phospholipase A2, also possesses anti-coagulant properties. Also cleaves the cyclic bond of inositol 1,2-cyclic phosphate to form inositol 1-phosphate.

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bone osteosarcoma	DIST1004	Definitive	Altered Expression	[1]
Osteosarcoma	DISLQ7E2	Definitive	Altered Expression	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[2]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[3]
Adenoma	DIS78ZEV	Strong	Genetic Variation	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Biomarker	[8]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[9]
Fibrosarcoma	DISWX7MU	Strong	Biomarker	[10]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[11]
Glaucoma/ocular hypertension	DISLBXBY	Strong	Biomarker	[12]
Graves disease	DISU4KOQ	Strong	Biomarker	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[14]
Huntington disease	DISQPLA4	Strong	Biomarker	[15]
Liver cancer	DISDE4BI	Strong	Biomarker	[8]
Lung cancer	DISCM4YA	Strong	Biomarker	[5]
Lung carcinoma	DISTR26C	Strong	Biomarker	[5]
Neoplasm	DISZKGEW	Strong	Biomarker	[16]
Neuralgia	DISWO58J	Strong	Biomarker	[17]
Promyelocytic leukaemia	DISYGG13	Strong	Altered Expression	[18]
Prostate cancer	DISF190Y	Strong	Biomarker	[19]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[20]
Schizophrenia	DISSRV2N	Strong	Biomarker	[21]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[11]
Triple negative breast cancer	DISAMG6N	Strong	Altered Expression	[7]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[6]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[6]
Prostate carcinoma	DISMJPLE	moderate	Biomarker	[19]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[22]
Epithelial ovarian cancer	DIS56MH2	Limited	Altered Expression	[23]
Human papillomavirus infection	DISX61LX	Limited	Biomarker	[24]
Metastatic malignant neoplasm	DIS86UK6	Limited	Altered Expression	[16]
Ovarian cancer	DISZJHAP	Limited	Biomarker	[25]
Ovarian neoplasm	DISEAFTY	Limited	Biomarker	[25]
Rheumatoid arthritis	DISTSB4J	Limited	Genetic Variation	[13]
Systemic lupus erythematosus	DISI1SZ7	Limited	Biomarker	[13]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic trioxide	DM61TA4	Approved	Annexin A3 (ANXA3) decreases the response to substance of Arsenic trioxide.	[62]

35 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Annexin A3 (ANXA3).	[26]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Annexin A3 (ANXA3).	[27]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Annexin A3 (ANXA3).	[28]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Annexin A3 (ANXA3).	[29]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Annexin A3 (ANXA3).	[30]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Annexin A3 (ANXA3).	[31]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Annexin A3 (ANXA3).	[32]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Annexin A3 (ANXA3).	[33]
Quercetin	DM3NC4M	Approved	Quercetin affects the expression of Annexin A3 (ANXA3).	[35]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Annexin A3 (ANXA3).	[36]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Annexin A3 (ANXA3).	[37]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Annexin A3 (ANXA3).	[38]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Annexin A3 (ANXA3).	[37]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Annexin A3 (ANXA3).	[39]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Annexin A3 (ANXA3).	[40]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Annexin A3 (ANXA3).	[41]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Annexin A3 (ANXA3).	[42]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Annexin A3 (ANXA3).	[43]
Simvastatin	DM30SGU	Approved	Simvastatin decreases the expression of Annexin A3 (ANXA3).	[44]
Ibuprofen	DM8VCBE	Approved	Ibuprofen affects the expression of Annexin A3 (ANXA3).	[45]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Annexin A3 (ANXA3).	[46]
Rofecoxib	DM3P5DA	Approved	Rofecoxib increases the expression of Annexin A3 (ANXA3).	[45]
Dopamine	DMPGUCF	Approved	Dopamine increases the expression of Annexin A3 (ANXA3).	[47]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Annexin A3 (ANXA3).	[48]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Annexin A3 (ANXA3).	[50]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Annexin A3 (ANXA3).	[52]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Annexin A3 (ANXA3).	[53]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Annexin A3 (ANXA3).	[54]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Annexin A3 (ANXA3).	[55]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Annexin A3 (ANXA3).	[56]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Annexin A3 (ANXA3).	[57]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Annexin A3 (ANXA3).	[58]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Annexin A3 (ANXA3).	[59]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Annexin A3 (ANXA3).	[60]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Annexin A3 (ANXA3).	[61]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Annexin A3 (ANXA3).	[34]

2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the cleavage of Annexin A3 (ANXA3).	[49]
DNCB	DMDTVYC	Phase 2	DNCB affects the binding of Annexin A3 (ANXA3).	[51]

References

• [1] Expression and significance of Annexin A3 in the osteosarcoma cell lines HOS and U2OS.Mol Med Rep. 2019 Sep;20(3):2583-2590. doi: 10.3892/mmr.2019.10513. Epub 2019 Jul 23.
• [2] Gene expression profiling of acute myeloid leukemia samples from adult patients with AML-M1 and -M2 through boutique microarrays, real-time PCR and droplet digital PCR.Int J Oncol. 2018 Mar;52(3):656-678. doi: 10.3892/ijo.2017.4233. Epub 2017 Dec 28.
• [3] Annexin A3 gene silencing promotes myocardial cell repair through activation of the PI3K/Akt signaling pathway in rats with acute myocardial infarction.J Cell Physiol. 2019 Jul;234(7):10535-10546. doi: 10.1002/jcp.27717. Epub 2018 Nov 19.
• [4] Identification of distinctive protein expression patterns in colorectal adenoma.Proteomics Clin Appl. 2010 Jan;4(1):60-70. doi: 10.1002/prca.200900084. Epub 2009 Nov 3.
• [5] Cancer-associated fibroblasts contribute to cisplatin resistance by modulating ANXA3 in lung cancer cells.Cancer Sci. 2019 May;110(5):1609-1620. doi: 10.1111/cas.13998. Epub 2019 Apr 9.
• [6] Systematic verification of bladder cancer-associated tissue protein biomarker candidates in clinical urine specimens.Oncotarget. 2018 Jul 20;9(56):30731-30747. doi: 10.18632/oncotarget.24578. eCollection 2018 Jul 20.
• [7] The expression of ANXA3 and its relationship with the occurrence and development of breast cancer.J BUON. 2018 May-Jun;23(3):713-719.
• [8] Annexin A3 as a potential target for immunotherapy of liver cancer stem-like cells.Stem Cells. 2015 Feb;33(2):354-66. doi: 10.1002/stem.1850.
• [9] A proteomic approach for the identification of biomarkers in endometrial cancer uterine aspirate.Oncotarget. 2017 Nov 30;8(65):109536-109545. doi: 10.18632/oncotarget.22725. eCollection 2017 Dec 12.
• [10] Proteomic Differences in Feline Fibrosarcomas Grown Using Doxorubicin-Sensitive and -Resistant Cell Lines in the Chick Embryo Model.Int J Mol Sci. 2018 Feb 14;19(2):576. doi: 10.3390/ijms19020576.
• [11] Impact of Annexin A3 expression in gastric cancer cells.Neoplasma. 2014;61(3):257-64. doi: 10.4149/neo_2014_033.
• [12] Changes in gene expression in experimental glaucoma and optic nerve transection: the equilibrium between protective and detrimental mechanisms.Invest Ophthalmol Vis Sci. 2007 Dec;48(12):5539-48. doi: 10.1167/iovs.07-0542.
• [13] Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population.Nat Genet. 2012 Mar 25;44(5):511-6. doi: 10.1038/ng.2231.
• [14] Application of Serum Annexin A3 in Diagnosis, Outcome Prediction and Therapeutic Response Evaluation for Patients with Hepatocellular Carcinoma.Ann Surg Oncol. 2018 Jun;25(6):1686-1694. doi: 10.1245/s10434-018-6402-0. Epub 2018 Apr 6.
• [15] Huntington's disease biomarker progression profile identified by transcriptome sequencing in peripheral blood.Eur J Hum Genet. 2015 Oct;23(10):1349-56. doi: 10.1038/ejhg.2014.281. Epub 2015 Jan 28.
• [16] Downregulation of annexin A3 inhibits tumor metastasis and decreases drug resistance in breast cancer.Cell Death Dis. 2018 Jan 26;9(2):126. doi: 10.1038/s41419-017-0143-z.
• [17] Proteomic Identification of an Upregulated Isoform of Annexin A3 in the Spinal Cords of Rats in a Neuropathic Pain Model.Front Neurosci. 2017 Sep 5;11:484. doi: 10.3389/fnins.2017.00484. eCollection 2017.
• [18] Participation of delta annexin A3 in the ribosomal protein S19 C-terminus-dependent inhibitory mechanism of the neutrophil C5a receptor through delta lactoferrin.Pathol Int. 2018 Feb;68(2):109-116. doi: 10.1111/pin.12626. Epub 2017 Dec 29.
• [19] Self-Normalized Detection of ANXA3 from Untreated Urine of Prostate Cancer Patients without Digital Rectal Examination.Adv Healthc Mater. 2017 Sep;6(17). doi: 10.1002/adhm.201700449. Epub 2017 Jul 13.
• [20] Identification of genes potentially involved in the acquisition of androgen-independent and metastatic tumor growth in an autochthonous genetically engineered mouse prostate cancer model.Prostate. 2007 Jan 1;67(1):83-106. doi: 10.1002/pros.20505.
• [21] Reduced Annexin A3 in schizophrenia.Eur Arch Psychiatry Clin Neurosci. 2020 Jun;270(4):489-494. doi: 10.1007/s00406-019-01048-3. Epub 2019 Aug 1.
• [22] Annexin A3 depletion overcomes resistance to oxaliplatin in colorectal cancer via the MAPK signaling pathway.J Cell Biochem. 2019 Sep;120(9):14585-14593. doi: 10.1002/jcb.28720. Epub 2019 Apr 18.
• [23] Increased expression of annexin A3 is a mechanism of platinum resistance in ovarian cancer.Cancer Res. 2010 Feb 15;70(4):1616-24. doi: 10.1158/0008-5472.CAN-09-3215. Epub 2010 Jan 26.
• [24] Hybrid capture based human papillomavirus typing in cervical screening compared to cytology and histology.Wien Klin Wochenschr. 2000 Sep 15;112(17):761-6.
• [25] Secretion of annexin A3 from ovarian cancer cells and its association with platinum resistance in ovarian cancer patients.J Cell Mol Med. 2012 Feb;16(2):337-48. doi: 10.1111/j.1582-4934.2011.01316.x.
• [26] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [27] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [28] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [29] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [30] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [31] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [32] Research resource: STR DNA profile and gene expression comparisons of human BG-1 cells and a BG-1/MCF-7 clonal variant. Mol Endocrinol. 2014 Dec;28(12):2072-81.
• [33] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [34] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [35] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [36] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [37] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [38] Proteomic analysis of liver cancer cells treated with suberonylanilide hydroxamic acid. Cancer Chemother Pharmacol. 2008 Apr;61(5):791-802.
• [39] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [40] Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
• [41] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [42] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [43] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [44] Simvastatin inactivates beta1-integrin and extracellular signal-related kinase signaling and inhibits cell proliferation in head and neck squamous cell carcinoma cells. Cancer Sci. 2007 Jun;98(6):890-9.
• [45] Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
• [46] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [47] Mitochondrial proteomics investigation of a cellular model of impaired dopamine homeostasis, an early step in Parkinson's disease pathogenesis. Mol Biosyst. 2014 Jun;10(6):1332-44.
• [48] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [49] Resveratrol depletes mitochondrial DNA and inhibition of autophagy enhances resveratrol-induced caspase activation. Mitochondrion. 2013 Sep;13(5):493-9. doi: 10.1016/j.mito.2012.10.010. Epub 2012 Oct 23.
• [50] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [51] Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
• [52] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [53] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [54] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [55] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [56] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [57] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [58] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [59] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [60] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
• [61] Annexin A3 may play an important role in ochratoxin-induced malignant transformation of human gastric epithelium cells. Toxicol Lett. 2019 Oct 1;313:150-158. doi: 10.1016/j.toxlet.2019.07.002. Epub 2019 Jul 2.
• [62] The NRF2-mediated oxidative stress response pathway is associated with tumor cell resistance to arsenic trioxide across the NCI-60 panel. BMC Med Genomics. 2010 Aug 13;3:37. doi: 10.1186/1755-8794-3-37.