Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGPJIRA)

• DOT Name: Early growth response protein 3 (EGR3)
• Synonyms: EGR-3; Zinc finger protein pilot
• Gene Name: EGR3
• Related Disease:
  Bipolar disorder
  Non-insulin dependent diabetes
  Adenoma
  Adult lymphoma
  Autoimmune disease
  B-cell lymphoma
  Breast cancer
  Breast carcinoma
  Depression
  Dowling-Degos disease
  Epilepsy
  Hepatitis B virus infection
  Hepatocellular carcinoma
  leukaemia
  Leukemia
  Lymphoma
  Melanoma
  Mental disorder
  Metastatic malignant neoplasm
  Non-small-cell lung cancer
  Pancreatic cancer
  Pediatric lymphoma
  Polycystic ovarian syndrome
  Postmenopausal osteoporosis
  Postpartum depression
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Schizoaffective disorder
  Scleroderma
  Sensory ataxia
  Small lymphocytic lymphoma
  Status epilepticus seizure
  Systemic lupus erythematosus
  Systemic sclerosis
  Wilms tumor
  Advanced cancer
  Bipolar I disorder
  Brugada syndrome
  Coronary atherosclerosis
  Coronary heart disease
  Cutaneous squamous cell carcinoma
  Malaria
  Neoplasm
  Post-traumatic stress disorder
• UniProt ID: EGR3_HUMAN
• Pfam ID: PF11928 ; PF00096
• Sequence:
  MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLT
  NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
  STQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAK
  PALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
  PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
  GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
  KKAEKGGAPSASSAPPVSLAPVVTTCA
• Function: Probable transcription factor involved in muscle spindle development.
• KEGG Pathway:
  C-type lectin receptor sig.ling pathway (hsa04625)
  Hepatitis B (hsa05161)
  Viral carcinogenesis (hsa05203)
• Reactome Pathway: NGF-stimulated transcription (R-HSA-9031628)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bipolar disorder	DISAM7J2	Definitive	Biomarker	[1]
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Biomarker	[2]
Adenoma	DIS78ZEV	Strong	Genetic Variation	[3]
Adult lymphoma	DISK8IZR	Strong	Altered Expression	[4]
Autoimmune disease	DISORMTM	Strong	Biomarker	[5]
B-cell lymphoma	DISIH1YQ	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Depression	DIS3XJ69	Strong	Biomarker	[8]
Dowling-Degos disease	DISGTTEP	Strong	Genetic Variation	[9]
Epilepsy	DISBB28L	Strong	Biomarker	[10]
Hepatitis B virus infection	DISLQ2XY	Strong	Altered Expression	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[5]
leukaemia	DISS7D1V	Strong	Biomarker	[12]
Leukemia	DISNAKFL	Strong	Biomarker	[12]
Lymphoma	DISN6V4S	Strong	Altered Expression	[4]
Melanoma	DIS1RRCY	Strong	Biomarker	[13]
Mental disorder	DIS3J5R8	Strong	Biomarker	[8]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[14]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[15]
Pancreatic cancer	DISJC981	Strong	Biomarker	[16]
Pediatric lymphoma	DIS51BK2	Strong	Altered Expression	[4]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Genetic Variation	[17]
Postmenopausal osteoporosis	DISS0RQZ	Strong	Genetic Variation	[18]
Postpartum depression	DIS08UKE	Strong	Biomarker	[19]
Prostate cancer	DISF190Y	Strong	Biomarker	[20]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[20]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[21]
Schizoaffective disorder	DISLBW6B	Strong	Biomarker	[22]
Scleroderma	DISVQ342	Strong	Altered Expression	[23]
Sensory ataxia	DISSMCYQ	Strong	Biomarker	[10]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[24]
Status epilepticus seizure	DISY3BIC	Strong	Biomarker	[10]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[25]
Systemic sclerosis	DISF44L6	Strong	Altered Expression	[23]
Wilms tumor	DISB6T16	Strong	Altered Expression	[26]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[27]
Bipolar I disorder	DISD09EH	Limited	Biomarker	[28]
Brugada syndrome	DISSGN0E	Limited	Biomarker	[29]
Coronary atherosclerosis	DISKNDYU	Limited	Genetic Variation	[30]
Coronary heart disease	DIS5OIP1	Limited	Genetic Variation	[30]
Cutaneous squamous cell carcinoma	DIS3LXUG	Limited	Altered Expression	[31]
Malaria	DISQ9Y50	Limited	Genetic Variation	[32]
Neoplasm	DISZKGEW	Limited	Altered Expression	[33]
Post-traumatic stress disorder	DISHL1EY	Limited	Biomarker	[34]

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Early growth response protein 3 (EGR3).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Early growth response protein 3 (EGR3).	[36]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate affects the expression of Early growth response protein 3 (EGR3).	[37]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Early growth response protein 3 (EGR3).	[38]
Ivermectin	DMDBX5F	Approved	Ivermectin increases the expression of Early growth response protein 3 (EGR3).	[39]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Early growth response protein 3 (EGR3).	[40]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Early growth response protein 3 (EGR3).	[41]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Early growth response protein 3 (EGR3).	[42]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Early growth response protein 3 (EGR3).	[43]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Early growth response protein 3 (EGR3).	[44]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Early growth response protein 3 (EGR3).	[45]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Early growth response protein 3 (EGR3).	[46]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Early growth response protein 3 (EGR3).	[47]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Early growth response protein 3 (EGR3).	[48]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Early growth response protein 3 (EGR3).	[38]
Estrone	DM5T6US	Approved	Estrone increases the expression of Early growth response protein 3 (EGR3).	[38]
Bexarotene	DMOBIKY	Approved	Bexarotene decreases the expression of Early growth response protein 3 (EGR3).	[49]
Mestranol	DMG3F94	Approved	Mestranol increases the expression of Early growth response protein 3 (EGR3).	[45]
Estriol	DMOEM2I	Approved	Estriol increases the expression of Early growth response protein 3 (EGR3).	[38]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Early growth response protein 3 (EGR3).	[50]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Early growth response protein 3 (EGR3).	[36]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Early growth response protein 3 (EGR3).	[38]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Early growth response protein 3 (EGR3).	[52]
HEXESTROL	DM9AGWQ	Withdrawn from market	HEXESTROL increases the expression of Early growth response protein 3 (EGR3).	[45]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Early growth response protein 3 (EGR3).	[38]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Early growth response protein 3 (EGR3).	[35]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Early growth response protein 3 (EGR3).	[53]
ELLAGIC ACID	DMX8BS5	Investigative	ELLAGIC ACID decreases the expression of Early growth response protein 3 (EGR3).	[54]
Pyrrolidine dithiocarbamate	DM5ZAS6	Investigative	Pyrrolidine dithiocarbamate increases the expression of Early growth response protein 3 (EGR3).	[55]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Early growth response protein 3 (EGR3).	[51]

References

• [1] EGR3 Immediate Early Gene and the Brain-Derived Neurotrophic Factor in Bipolar Disorder.Front Behav Neurosci. 2018 Feb 5;12:15. doi: 10.3389/fnbeh.2018.00015. eCollection 2018.
• [2] DEXAMETHASONE STRESS TEST: A PILOT CLINICAL STUDY FOR IDENTIFICATION OF INDIVIDUALS HIGHLY PRONE TO DEVELOP TYPE 2 DIABETES.Endocr Pract. 2018 Oct 2;24(10):894-899. doi: 10.4158/EP-2018-0188. Epub 2018 Aug 7.
• [3] MIFEPRISTONE TREATMENT FOR MILD AUTONOMOUS CORTISOL SECRETION DUE TO ADRENAL ADENOMAS: A PILOT STUDY.Endocr Pract. 2019 Aug;25(8):846-853. doi: 10.4158/EP-2019-0047. Epub 2019 May 9.
• [4] Overexpression of the immediate-early genes Egr1, Egr2, and Egr3 in two strains of rodents susceptible to audiogenic seizures.Epilepsy Behav. 2017 Jun;71(Pt B):226-237. doi: 10.1016/j.yebeh.2015.12.020. Epub 2016 Jan 14.
• [5] Early growth response 3 inhibits growth of hepatocellular carcinoma cells via upregulation of Fas ligand.Int J Oncol. 2017 Mar;50(3):805-814. doi: 10.3892/ijo.2017.3855. Epub 2017 Jan 18.
• [6] Low Plasma Omega-3 Fatty Acid Levels May Predict Inferior Prognosis in Untreated Diffuse Large B-Cell Lymphoma: A New Modifiable Dietary Biomarker?.Nutr Cancer. 2018 Oct;70(7):1088-1090. doi: 10.1080/01635581.2018.1502328. Epub 2018 Sep 20.
• [7] Estrogen signaling in cancer microenvironment and prediction of response to hormonal therapy.J Steroid Biochem Mol Biol. 2008 Apr;109(3-5):201-6. doi: 10.1016/j.jsbmb.2008.03.013. Epub 2008 Mar 12.
• [8] The Immediate Early Gene Egr3 Is Required for Hippocampal Induction of Bdnf by Electroconvulsive Stimulation.Front Behav Neurosci. 2018 May 11;12:92. doi: 10.3389/fnbeh.2018.00092. eCollection 2018.
• [9] Polymorphic variation of the guanosine triphosphate cyclohydrolase 1 gene predicts outcome in patients undergoing surgical treatment for lumbar degenerative disc disease.Spine (Phila Pa 1976). 2010 Oct 1;35(21):1909-14. doi: 10.1097/BRS.0b013e3181eea007.
• [10] Egr3 stimulation of GABRA4 promoter activity as a mechanism for seizure-induced up-regulation of GABA(A) receptor alpha4 subunit expression.Proc Natl Acad Sci U S A. 2005 Aug 16;102(33):11894-9. doi: 10.1073/pnas.0501434102. Epub 2005 Aug 9.
• [11] Hepatitis B virus X protein induces expression of Fas ligand gene through enhancing transcriptional activity of early growth response factor.J Biol Chem. 2004 Aug 27;279(35):36242-9. doi: 10.1074/jbc.M401290200. Epub 2004 Jun 1.
• [12] Megakaryocyte-derived excessive transforming growth factor 1 inhibits proliferation of normal hematopoietic stem cells in acute myeloid leukemia.Exp Hematol. 2018 Apr;60:40-46.e2. doi: 10.1016/j.exphem.2017.12.010. Epub 2018 Jan 4.
• [13] Vascular endothelial growth factor activation of endothelial cells is mediated by early growth response-3.Blood. 2010 Mar 25;115(12):2520-32. doi: 10.1182/blood-2009-07-233478. Epub 2009 Nov 23.
• [14] Prognostic significance of miR-34a in Ewing sarcoma is associated with cyclin D1 and ki-67 expression.Ann Oncol. 2014 Oct;25(10):2080-2086. doi: 10.1093/annonc/mdu249. Epub 2014 Jul 10.
• [15] KSRP suppresses cell invasion and metastasis through miR-23a-mediated EGR3 mRNA degradation in non-small cell lung cancer.Biochim Biophys Acta Gene Regul Mech. 2017 Oct;1860(10):1013-1024. doi: 10.1016/j.bbagrm.2017.08.005. Epub 2017 Aug 25.
• [16] Induction, modulation and potential targets of miR-210 in pancreatic cancer cells.Hepatobiliary Pancreat Dis Int. 2012 Jun;11(3):319-24. doi: 10.1016/s1499-3872(12)60168-4.
• [17] DPP4 INHIBITOR SITAGLIPTIN AS A POTENTIAL TREATMENT OPTION IN METFORMIN-INTOLERANT OBESE WOMEN WITH POLYCYSTIC OVARY SYNDROME: A PILOT RANDOMIZED STUDY.Endocr Pract. 2018 Jan;24(1):69-77. doi: 10.4158/EP-2017-0027. Epub 2017 Nov 16.
• [18] ANABOLIC BONE WINDOW WITH WEEKLY TERIPARATIDE THERAPY IN POSTMENOPAUSAL OSTEOPOROSIS: A PILOT STUDY.Endocr Pract. 2017 Jun;23(6):657-661. doi: 10.4158/EP161394.OR. Epub 2017 Feb 22.
• [19] A systematic review investigating if genetic or epigenetic markers are associated with postnatal depression.J Affect Disord. 2019 Jun 15;253:51-62. doi: 10.1016/j.jad.2019.04.059. Epub 2019 Apr 9.
• [20] Overexpressing miR?35 inhibits DU145 cell proliferation by targeting early growth response 3 in prostate cancer.Int J Oncol. 2019 Jun;54(6):1981-1994. doi: 10.3892/ijo.2019.4778. Epub 2019 Apr 9.
• [21] Early Growth Response 3 regulates genes of inflammation and directly activates IL6 and IL8 expression in prostate cancer.Br J Cancer. 2015 Feb 17;112(4):755-64. doi: 10.1038/bjc.2014.622. Epub 2015 Jan 29.
• [22] Association study of 21 circadian genes with bipolar I disorder, schizoaffective disorder, and schizophrenia.Bipolar Disord. 2009 Nov;11(7):701-10. doi: 10.1111/j.1399-5618.2009.00756.x.
• [23] Early growth response 3 (Egr-3) is induced by transforming growth factor- and regulates fibrogenic responses.Am J Pathol. 2013 Oct;183(4):1197-1208. doi: 10.1016/j.ajpath.2013.06.016. Epub 2013 Jul 30.
• [24] ZAP-70 expression identifies a chronic lymphocytic leukemia subtype with unmutated immunoglobulin genes, inferior clinical outcome, and distinct gene expression profile.Blood. 2003 Jun 15;101(12):4944-51. doi: 10.1182/blood-2002-10-3306. Epub 2003 Feb 20.
• [25] Dysregulation of anergy-related factors involved in regulatory T cells defects in Systemic Lupus Erythematosus patients: Rapamycin and Vitamin D efficacy in restoring regulatory T cells.Int J Rheum Dis. 2016 Dec;19(12):1294-1303. doi: 10.1111/1756-185X.12509. Epub 2014 Oct 28.
• [26] Transcriptional and post-transcriptional regulation of Sprouty1, a receptor tyrosine kinase inhibitor in prostate cancer.Prostate Cancer Prostatic Dis. 2011 Dec;14(4):279-85. doi: 10.1038/pcan.2011.33. Epub 2011 Aug 9.
• [27] The expression of RUNDC3B is associated with promoter methylation in lymphoid malignancies.Hematol Oncol. 2017 Mar;35(1):25-33. doi: 10.1002/hon.2238. Epub 2015 May 25.
• [28] Family-based association study of early growth response gene 3 with child bipolar I disorder.J Affect Disord. 2012 May;138(3):387-96. doi: 10.1016/j.jad.2012.01.011. Epub 2012 Feb 25.
• [29] Is sudden unexplained nocturnal death syndrome in Southern China a cardiac sodium channel dysfunction disorder?.Forensic Sci Int. 2014 Mar;236:38-45. doi: 10.1016/j.forsciint.2013.12.033. Epub 2014 Jan 7.
• [30] Association of Egr3 genetic polymorphisms and coronary artery disease in the Uygur and Han of China.Lipids Health Dis. 2014 May 21;13:84. doi: 10.1186/1476-511X-13-84.
• [31] Identification of Biomarker for Cutaneous Squamous Cell Carcinoma Using Microarray Data Analysis.J Cancer. 2018 Jan 1;9(2):400-406. doi: 10.7150/jca.21381. eCollection 2018.
• [32] Profiling the malaria genome: a gene survey of three species of malaria parasite with comparison to other apicomplexan species.Mol Biochem Parasitol. 2001 Dec;118(2):201-10. doi: 10.1016/s0166-6851(01)00371-1.
• [33] Involvement of microRNA-718, a new regulator of EGR3, in regulation of malignant phenotype of HCC cells.J Zhejiang Univ Sci B. 2017 Jan.;18(1):27-36. doi: 10.1631/jzus.B1600205.
• [34] Management of post-traumatic stress disorder: A protocol for a multiple treatment comparison meta-analysis of randomized controlled trials.Medicine (Baltimore). 2019 Sep;98(39):e17064. doi: 10.1097/MD.0000000000017064.
• [35] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [36] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [37] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [38] Using a customized DNA microarray for expression profiling of the estrogen-responsive genes to evaluate estrogen activity among natural estrogens and industrial chemicals. Environ Health Perspect. 2004 May;112(7):773-81. doi: 10.1289/ehp.6753.
• [39] A Gene Expression Biomarker Identifies Chemical Modulators of Estrogen Receptor in an MCF-7 Microarray Compendium. Chem Res Toxicol. 2021 Feb 15;34(2):313-329. doi: 10.1021/acs.chemrestox.0c00243. Epub 2021 Jan 6.
• [40] Inorganic arsenic promotes luminal to basal transition and metastasis of breast cancer. FASEB J. 2020 Dec;34(12):16034-16048. doi: 10.1096/fj.202001192R. Epub 2020 Oct 13.
• [41] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [42] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [43] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [44] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [45] Moving toward integrating gene expression profiling into high-throughput testing: a gene expression biomarker accurately predicts estrogen receptor alpha modulation in a microarray compendium. Toxicol Sci. 2016 May;151(1):88-103.
• [46] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [47] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [48] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [49] Identification of biomarkers modulated by the rexinoid LGD1069 (bexarotene) in human breast cells using oligonucleotide arrays. Cancer Res. 2006 Dec 15;66(24):12009-18.
• [50] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [51] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [52] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [53] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [54] Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.
• [55] Effects of a redox-active agent on lymphocyte activation and early gene expression patterns. Free Radic Biol Med. 2004 Nov 15;37(10):1550-63.