Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ86KI6)

• DOT Name: Macrophage-capping protein (CAPG)
• Synonyms: Actin regulatory protein CAP-G
• Gene Name: CAPG
• Related Disease:
  Adult glioblastoma
  Amyotrophic lateral sclerosis
  Epithelial ovarian cancer
  Ovarian cancer
  Acute lymphocytic leukaemia
  Acute myelogenous leukaemia
  Advanced cancer
  Alzheimer disease
  Arteriosclerosis
  Arthritis
  Atherosclerosis
  Atypical hemolytic uremic syndrome
  B-cell neoplasm
  Breast neoplasm
  Cardiac failure
  Childhood acute lymphoblastic leukemia
  Clear cell renal carcinoma
  Colorectal carcinoma
  Congestive heart failure
  Coronary atherosclerosis
  Coronary heart disease
  Endometrial cancer
  Endometrial carcinoma
  Gastric cancer
  Glioma
  Hemolytic-uremic syndrome
  Keloid
  Lung adenocarcinoma
  Neoplasm
  Neuroblastoma
  Osteoarthritis
  Papillary renal cell carcinoma
  Renal cell carcinoma
  Stomach cancer
  Systemic lupus erythematosus
  Systemic sclerosis
  Autism spectrum disorder
  Glioblastoma multiforme
  Prostate cancer
  Prostate carcinoma
  Rheumatoid arthritis
  Adenocarcinoma
  Breast cancer
  Breast carcinoma
• UniProt ID: CAPG_HUMAN
• PDB ID: 1J72; 1JHW
• Pfam ID: PF00626
• Sequence:
  MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSH
  LHLWIGQQSSRDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGG
  VESAFHKTSTGAPAAIKKLYQVKGKKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGG
  KSNILERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLT
  ADKANAQAAALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRK
  ANEKERQAALQVAEGFISRMQYAPNTQVEILPQGHESPIFKQFFKDWK
• Function: Calcium-sensitive protein which reversibly blocks the barbed ends of actin filaments but does not sever preformed actin filaments. May play an important role in macrophage function. May play a role in regulating cytoplasmic and/or nuclear structures through potential interactions with actin. May bind DNA.
• Tissue Specificity: Macrophages and macrophage-like cells.

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Definitive	Altered Expression	[1]
Amyotrophic lateral sclerosis	DISF7HVM	Definitive	Biomarker	[2]
Epithelial ovarian cancer	DIS56MH2	Definitive	Biomarker	[3]
Ovarian cancer	DISZJHAP	Definitive	Biomarker	[3]
Acute lymphocytic leukaemia	DISPX75S	Strong	Genetic Variation	[4]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[5]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[6]
Alzheimer disease	DISF8S70	Strong	Biomarker	[7]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[8]
Arthritis	DIST1YEL	Strong	Genetic Variation	[9]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[8]
Atypical hemolytic uremic syndrome	DIS6FUDJ	Strong	Genetic Variation	[10]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[11]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[12]
Cardiac failure	DISDC067	Strong	Biomarker	[13]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Genetic Variation	[4]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[14]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[15]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[13]
Coronary atherosclerosis	DISKNDYU	Strong	Biomarker	[16]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[16]
Endometrial cancer	DISW0LMR	Strong	Biomarker	[17]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[17]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[18]
Glioma	DIS5RPEH	Strong	Altered Expression	[19]
Hemolytic-uremic syndrome	DISSCBGW	Strong	Genetic Variation	[20]
Keloid	DISV09JY	Strong	Biomarker	[21]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[22]
Neoplasm	DISZKGEW	Strong	Biomarker	[23]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[24]
Osteoarthritis	DIS05URM	Strong	Biomarker	[25]
Papillary renal cell carcinoma	DIS25HBV	Strong	Biomarker	[14]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[14]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[18]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[26]
Systemic sclerosis	DISF44L6	Strong	Biomarker	[27]
Autism spectrum disorder	DISXK8NV	moderate	Altered Expression	[28]
Glioblastoma multiforme	DISK8246	moderate	Altered Expression	[19]
Prostate cancer	DISF190Y	moderate	Biomarker	[29]
Prostate carcinoma	DISMJPLE	moderate	Biomarker	[29]
Rheumatoid arthritis	DISTSB4J	moderate	Biomarker	[30]
Adenocarcinoma	DIS3IHTY	Limited	Biomarker	[31]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[6]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[6]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Macrophage-capping protein (CAPG) decreases the response to substance of Arsenic.	[54]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Macrophage-capping protein (CAPG).	[32]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Macrophage-capping protein (CAPG).	[51]

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Macrophage-capping protein (CAPG).	[33]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Macrophage-capping protein (CAPG).	[34]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Macrophage-capping protein (CAPG).	[35]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Macrophage-capping protein (CAPG).	[36]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Macrophage-capping protein (CAPG).	[37]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Macrophage-capping protein (CAPG).	[38]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Macrophage-capping protein (CAPG).	[39]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Macrophage-capping protein (CAPG).	[40]
Selenium	DM25CGV	Approved	Selenium increases the expression of Macrophage-capping protein (CAPG).	[41]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Macrophage-capping protein (CAPG).	[42]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Macrophage-capping protein (CAPG).	[43]
Etretinate	DM2CZFA	Approved	Etretinate increases the expression of Macrophage-capping protein (CAPG).	[44]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Macrophage-capping protein (CAPG).	[45]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Macrophage-capping protein (CAPG).	[46]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Macrophage-capping protein (CAPG).	[47]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Macrophage-capping protein (CAPG).	[33]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Macrophage-capping protein (CAPG).	[41]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Macrophage-capping protein (CAPG).	[48]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Macrophage-capping protein (CAPG).	[49]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Macrophage-capping protein (CAPG).	[50]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Macrophage-capping protein (CAPG).	[42]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Macrophage-capping protein (CAPG).	[52]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Macrophage-capping protein (CAPG).	[53]

References

• [1] Actin-capping protein CapG is associated with prognosis, proliferation and metastasis in human glioma.Oncol Rep. 2018 Mar;39(3):1011-1022. doi: 10.3892/or.2018.6225. Epub 2018 Jan 22.
• [2] Proteomics in cerebrospinal fluid and spinal cord suggests UCHL1, MAP2 and GPNMB as biomarkers and underpins importance of transcriptional pathways in amyotrophic lateral sclerosis.Acta Neuropathol. 2020 Jan;139(1):119-134. doi: 10.1007/s00401-019-02093-x. Epub 2019 Nov 7.
• [3] Macrophage capping protein CapG is a putative oncogene involved in migration and invasiveness in ovarian carcinoma.Biomed Res Int. 2014;2014:379847. doi: 10.1155/2014/379847. Epub 2014 Apr 2.
• [4] Classification and regression tree-based prediction of 6-mercaptopurine-induced leucopenia grades in children with acute lymphoblastic leukemia.Cancer Chemother Pharmacol. 2019 May;83(5):875-880. doi: 10.1007/s00280-019-03803-8. Epub 2019 Feb 26.
• [5] Epigenetic-based treatments emphasize the biologic differences of core-binding factor acute myeloid leukemias.Leuk Res. 2008 Jun;32(6):944-53. doi: 10.1016/j.leukres.2007.11.038. Epub 2008 Feb 21.
• [6] CAPG enhances breast cancer metastasis by competing with PRMT5 to modulate STC-1 transcription.Theranostics. 2018 Apr 3;8(9):2549-2564. doi: 10.7150/thno.22523. eCollection 2018.
• [7] Adenovirus E1A inhibits IFN-induced resistance to cytolysis by natural killer cells.J Immunol. 1993 May 15;150(10):4315-22.
• [8] Monocyte chemoattractant protein-1 (MCP-1) and fibroblast growth factor-21 (FGF-21) as biomarkers of subclinical atherosclerosis in women.Exp Gerontol. 2019 Sep;124:110624. doi: 10.1016/j.exger.2019.05.013. Epub 2019 May 29.
• [9] Polymyalgia rheumatica can be distinguished from late onset rheumatoid arthritis at baseline: results of a 5-yr prospective study.Rheumatology (Oxford). 2009 Feb;48(2):123-7. doi: 10.1093/rheumatology/ken343. Epub 2008 Nov 2.
• [10] Atypical hemolytic-uremic syndrome: recurrent phenotypic expression of a patient with MCP gene mutation combined with risk haplotypes.Blood Coagul Fibrinolysis. 2019 Mar;30(2):68-70. doi: 10.1097/MBC.0000000000000793.
• [11] High expression of membrane cofactor protein of complement (CD46) in human leukaemia cell lines: implication of an alternatively spliced form containing the STA domain in CD46 up-regulation.Scand J Immunol. 1995 Dec;42(6):581-90. doi: 10.1111/j.1365-3083.1995.tb03700.x.
• [12] Dynamics of the CapG actin-binding protein in the cell nucleus studied by FRAP and FCS.Chromosome Res. 2008;16(3):427-37. doi: 10.1007/s10577-008-1234-6.
• [13] Perindopril and a Galectin-3 Inhibitor Improve Ischemic Heart Failure in Rabbits by Reducing Gal-3 Expression and Myocardial Fibrosis.Front Physiol. 2019 Mar 22;10:267. doi: 10.3389/fphys.2019.00267. eCollection 2019.
• [14] Differential protein profiling in renal-cell carcinoma.Mol Carcinog. 2004 May;40(1):47-61. doi: 10.1002/mc.20015.
• [15] Function of the macrophage-capping protein in colorectal carcinoma.Oncol Lett. 2017 Nov;14(5):5549-5555. doi: 10.3892/ol.2017.6888. Epub 2017 Sep 6.
• [16] Aberrant histone modifications of global histone and MCP-1 promoter in CD14(+) monocytes from patients with coronary artery disease.Pharmazie. 2018 Apr 2;73(4):202-206. doi: 10.1691/ph.2018.7342.
• [17] Targeted Proteomics Identifies Proteomic Signatures in Liquid Biopsies of the Endometrium to Diagnose Endometrial Cancer and Assist in the Prediction of the Optimal Surgical Treatment.Clin Cancer Res. 2017 Nov 1;23(21):6458-6467. doi: 10.1158/1078-0432.CCR-17-0474. Epub 2017 Aug 8.
• [18] Laser microdissection and two-dimensional difference gel electrophoresis reveal the role of a novel macrophage-capping protein in lymph node metastasis in gastric cancer.J Proteome Res. 2013 Aug 2;12(8):3780-91. doi: 10.1021/pr400439m. Epub 2013 Jul 9.
• [19] Analysis of clinical characteristics of macrophage capping protein (CAPG) gene expressed in glioma based on TCGA data and clinical experiments.Oncol Lett. 2019 Aug;18(2):1344-1350. doi: 10.3892/ol.2019.10396. Epub 2019 May 23.
• [20] Autoantibodies in haemolytic uraemic syndrome (HUS).Thromb Haemost. 2009 Feb;101(2):227-32.
• [21] Comparative proteomic analysis between normal skin and keloid scar.Br J Dermatol. 2010 Jun;162(6):1302-15. doi: 10.1111/j.1365-2133.2010.09660.x. Epub 2010 Feb 1.
• [22] Comparative proteome analysis of human adenocarcinoma.Med Oncol. 2010 Jun;27(2):346-56. doi: 10.1007/s12032-009-9216-x. Epub 2009 Apr 21.
• [23] In Situ One-Pot Synthesis of MOF-Polydopamine Hybrid Nanogels with Enhanced Photothermal Effect for Targeted Cancer Therapy.Adv Sci (Weinh). 2018 Apr 14;5(6):1800287. doi: 10.1002/advs.201800287. eCollection 2018 Jun.
• [24] Complement activation on human neuroblastoma cell lines in vitro: route of activation and expression of functional complement regulatory proteins.J Neuroimmunol. 1996 May;66(1-2):29-40. doi: 10.1016/0165-5728(96)00015-x.
• [25] Prevalence and distribution of cartilage damage at the metacarpal head level in rheumatoid arthritis and osteoarthritis: an ultrasound study.Rheumatology (Oxford). 2019 Jul 1;58(7):1206-1213. doi: 10.1093/rheumatology/key443.
• [26] A functional SNP MCP-1 (-2518A/G) predispose to renal disorder in Indian Systemic Lupus Erythematosus patients.Cytokine. 2017 Aug;96:189-194. doi: 10.1016/j.cyto.2017.04.016. Epub 2017 Apr 21.
• [27] The local complement activation on vascular bed of patients with systemic sclerosis: a hypothesis-generating study.PLoS One. 2015 Feb 6;10(2):e0114856. doi: 10.1371/journal.pone.0114856. eCollection 2015.
• [28] Homozygous 2p11.2 deletion supports the implication of ELMOD3 in hearing loss and reveals the potential association of CAPG with ASD/ID etiology.J Appl Genet. 2019 Feb;60(1):49-56. doi: 10.1007/s13353-018-0472-3. Epub 2018 Oct 4.
• [29] High Dimensional Variable Selection with Error Control.Biomed Res Int. 2016;2016:8209453. doi: 10.1155/2016/8209453. Epub 2016 Aug 15.
• [30] Diagnostic test accuracy of magnetic resonance imaging and ultrasound for detecting bone erosion in patients with rheumatoid arthritis.Clin Rheumatol. 2020 Apr;39(4):1283-1293. doi: 10.1007/s10067-019-04825-6. Epub 2019 Nov 12.
• [31] Four potential biomarkers as prognostic factors in stage III serous ovarian adenocarcinomas.Int J Cancer. 2008 Nov 1;123(9):2130-7. doi: 10.1002/ijc.23758.
• [32] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [33] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [34] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [35] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [36] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [37] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [38] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [39] Proteomic analysis revealed association of aberrant ROS signaling with suberoylanilide hydroxamic acid-induced autophagy in Jurkat T-leukemia cells. Autophagy. 2010 Aug;6(6):711-24. doi: 10.4161/auto.6.6.12397. Epub 2010 Aug 17.
• [40] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [41] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [42] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [43] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [44] Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
• [45] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [46] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [47] A novel long noncoding RNA AK001796 acts as an oncogene and is involved in cell growth inhibition by resveratrol in lung cancer. Toxicol Appl Pharmacol. 2015 Jun 1;285(2):79-88.
• [48] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [49] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [50] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [51] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [52] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [53] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [54] Gene expression levels in normal human lymphoblasts with variable sensitivities to arsenite: identification of GGT1 and NFKBIE expression levels as possible biomarkers of susceptibility. Toxicol Appl Pharmacol. 2008 Jan 15;226(2):199-205. doi: 10.1016/j.taap.2007.09.004. Epub 2007 Sep 15.