Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLT3JFN)

• DOT Name: Keratin, type II cytoskeletal 7 (KRT7)
• Synonyms: Cytokeratin-7; CK-7; Keratin-7; K7; Sarcolectin; Type-II keratin Kb7
• Gene Name: KRT7
• Related Disease:
  Advanced cancer
  Clear cell renal carcinoma
  Acute erythroid leukemia
  Acute myelogenous leukaemia
  Adenoma
  Adult T-cell leukemia/lymphoma
  Anorexia nervosa cachexia
  Attention deficit hyperactivity disorder
  Bladder cancer
  Bulimia nervosa
  Carcinoma
  Colorectal carcinoma
  Cutaneous squamous cell carcinoma
  Depression
  Eating disorder
  Hepatocellular carcinoma
  Huntington disease
  Leukemia
  Lung cancer
  Mental disorder
  Mixed anxiety and depressive disorder
  Obesity
  Papillary renal cell carcinoma
  Parkinson disease
  Post-traumatic stress disorder
  Primary biliary cholangitis
  Squamous cell carcinoma
  T-cell acute lymphoblastic leukaemia
  Urinary bladder cancer
  Urinary bladder neoplasm
  Acute undifferentiated leukemia
  Asthma
  Lung carcinoma
  Malignant soft tissue neoplasm
  Metastatic malignant neoplasm
  Sarcoma
  Systemic sclerosis
  Acute lymphocytic leukaemia
  Bone Paget disease
  Paget's disease
  Hepatitis C virus infection
  leukaemia
  Psychotic disorder
• UniProt ID: K2C7_HUMAN
• PDB ID: 4XIF
• Pfam ID: PF00038 ; PF16208
• Sequence:
  MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVG
  AGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLE
  TKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKY
  EDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQI
  SDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDD
  LRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAA
  LQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTG
  GSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
• Function: Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
• Tissue Specificity: Expressed in cultured epidermal, bronchial and mesothelial cells but absent in colon, ectocervix and liver. Observed throughout the glandular cells in the junction between stomach and esophagus but is absent in the esophagus.
• Reactome Pathway:
  Formation of the cornified envelope (R-HSA-6809371)
  Keratinization (R-HSA-6805567)

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Definitive	Biomarker	[1]
Clear cell renal carcinoma	DISBXRFJ	Definitive	Biomarker	[2]
Acute erythroid leukemia	DISZFC1O	Strong	Biomarker	[3]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[4]
Adenoma	DIS78ZEV	Strong	Biomarker	[5]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Biomarker	[6]
Anorexia nervosa cachexia	DISFO5RQ	Strong	Genetic Variation	[7]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Genetic Variation	[8]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[9]
Bulimia nervosa	DISGQ59Y	Strong	Genetic Variation	[10]
Carcinoma	DISH9F1N	Strong	Altered Expression	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[12]
Cutaneous squamous cell carcinoma	DIS3LXUG	Strong	Biomarker	[13]
Depression	DIS3XJ69	Strong	Genetic Variation	[14]
Eating disorder	DISVGXN0	Strong	Biomarker	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[16]
Huntington disease	DISQPLA4	Strong	Genetic Variation	[17]
Leukemia	DISNAKFL	Strong	Biomarker	[18]
Lung cancer	DISCM4YA	Strong	Biomarker	[19]
Mental disorder	DIS3J5R8	Strong	Biomarker	[20]
Mixed anxiety and depressive disorder	DISV809X	Strong	Genetic Variation	[21]
Obesity	DIS47Y1K	Strong	Biomarker	[22]
Papillary renal cell carcinoma	DIS25HBV	Strong	Biomarker	[23]
Parkinson disease	DISQVHKL	Strong	Genetic Variation	[24]
Post-traumatic stress disorder	DISHL1EY	Strong	Genetic Variation	[25]
Primary biliary cholangitis	DIS43E0O	Strong	Biomarker	[26]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[27]
T-cell acute lymphoblastic leukaemia	DIS17AI2	Strong	Biomarker	[28]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[9]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[9]
Acute undifferentiated leukemia	DISJ4SSG	moderate	Biomarker	[29]
Asthma	DISW9QNS	moderate	Genetic Variation	[30]
Lung carcinoma	DISTR26C	moderate	Altered Expression	[31]
Malignant soft tissue neoplasm	DISTC6NO	moderate	Biomarker	[32]
Metastatic malignant neoplasm	DIS86UK6	moderate	Altered Expression	[32]
Sarcoma	DISZDG3U	moderate	Biomarker	[32]
Systemic sclerosis	DISF44L6	moderate	Genetic Variation	[33]
Acute lymphocytic leukaemia	DISPX75S	Disputed	Genetic Variation	[34]
Bone Paget disease	DISIPS4V	Disputed	Altered Expression	[35]
Paget's disease	DISO3MC0	Disputed	Altered Expression	[35]
Hepatitis C virus infection	DISQ0M8R	Limited	Biomarker	[36]
leukaemia	DISS7D1V	Limited	Biomarker	[18]
Psychotic disorder	DIS4UQOT	Limited	Genetic Variation	[37]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Keratin, type II cytoskeletal 7 (KRT7) increases the response to substance of Paclitaxel.	[64]

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[38]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[39]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[40]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[41]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[42]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[43]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[44]
Selenium	DM25CGV	Approved	Selenium increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[45]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[46]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[47]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[48]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[40]
Alitretinoin	DMME8LH	Approved	Alitretinoin increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[40]
Beta-carotene	DM0RXBT	Approved	Beta-carotene affects the expression of Keratin, type II cytoskeletal 7 (KRT7).	[49]
Vitamin A	DMJ2AH4	Approved	Vitamin A increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[49]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[50]
Coprexa	DMA0WEK	Phase 3	Coprexa decreases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[51]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[53]
SB-431542	DM0YOXQ	Preclinical	SB-431542 increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[54]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[55]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[47]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[56]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[57]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[58]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine decreases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[59]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[60]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone affects the expression of Keratin, type II cytoskeletal 7 (KRT7).	[62]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate decreases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[63]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid increases the expression of Keratin, type II cytoskeletal 7 (KRT7).	[40]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Keratin, type II cytoskeletal 7 (KRT7).	[52]

1 Drug(s) Affected the Biochemical Pathways of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
acrolein	DMAMCSR	Investigative	acrolein increases the metabolism of Keratin, type II cytoskeletal 7 (KRT7).	[61]

References

• [1] FOXA1 promotes proliferation, migration and invasion by transcriptional activating KRT7 in human gastric cancer cells.J Biol Regul Homeost Agents. 2019 Jul-Aug;33(4):1041-1050.
• [2] Reactivity of CK7 across the spectrum of renal cell carcinomas with clear cells.Histopathology. 2019 Mar;74(4):608-617. doi: 10.1111/his.13791. Epub 2019 Jan 31.
• [3] A novel role for Lyl1 in primitive erythropoiesis.Development. 2018 Oct 11;145(19):dev162990. doi: 10.1242/dev.162990.
• [4] Pattern of expression and their clinical implications of the GATA family, stem cell leukemia gene, and EVI1 in leukemia and myelodysplastic syndromes.Leuk Lymphoma. 1996 Nov;23(5-6):431-6. doi: 10.3109/10428199609054850.
• [5] Ocular Adnexal Adenomatoid Sebaceous Gland Hyperplasia: A Clinical and Immunopathologic Analysis in Relation to the Muir-Torre Syndrome.Ophthalmic Plast Reconstr Surg. 2020 Jan/Feb;36(1):e6-e12. doi: 10.1097/IOP.0000000000001497.
• [6] The leukemic oncogene tal-2 is expressed in the developing mouse brain.Brain Res Mol Brain Res. 1999 Feb 5;64(2):199-210. doi: 10.1016/s0169-328x(98)00323-4.
• [7] Network analysis of specific psychopathology and psychiatric symptoms in patients with anorexia nervosa.Eur Eat Disord Rev. 2019 Jan;27(1):24-33. doi: 10.1002/erv.2633. Epub 2018 Jul 31.
• [8] Relationship of Probable Attention Deficit Hyperactivity Disorder with Severity of Psychopathology and Impulsivity in a Sample of Male Patients with Opioid Use Disorder.Psychiatry Investig. 2018 Feb;15(2):164-171. doi: 10.30773/pi.2017.05.14.1. Epub 2017 Dec 1.
• [9] Detection and Clinical Significance of Circulating Tumor Cells in Patients Undergoing Radical Cystectomy for Urothelial Bladder Cancer.Clin Genitourin Cancer. 2017 Aug;15(4):455-462. doi: 10.1016/j.clgc.2016.11.005. Epub 2016 Dec 1.
• [10] Exercise Obsession and Compulsion in Adults With Longstanding Eating Disorders: Validation of the Norwegian Version of the Compulsive Exercise Test.Front Psychol. 2019 Oct 22;10:2370. doi: 10.3389/fpsyg.2019.02370. eCollection 2019.
• [11] MAP17 overexpression is a common characteristic of carcinomas.Carcinogenesis. 2007 Aug;28(8):1646-52. doi: 10.1093/carcin/bgm083. Epub 2007 Apr 9.
• [12] Immunohistochemical staining of cytokeratin 20 and cytokeratin 7 in colorectal carcinomas: Four different immunostaining profiles.Saudi J Gastroenterol. 2018 Mar-Apr;24(2):129-134. doi: 10.4103/sjg.SJG_465_17.
• [13] Fibulin-3 Has Anti-Tumorigenic Activities inCutaneous Squamous Cell Carcinoma.J Invest Dermatol. 2019 Aug;139(8):1798-1808.e5. doi: 10.1016/j.jid.2019.01.022. Epub 2019 Feb 6.
• [14] Explanatory variables for women's increased risk for mental health problems in Vietnam.Soc Psychiatry Psychiatr Epidemiol. 2020 Mar;55(3):359-369. doi: 10.1007/s00127-019-01761-3. Epub 2019 Aug 28.
• [15] Kindness begins with yourself: The role of self-compassion in adolescent body satisfaction and eating pathology.Int J Eat Disord. 2019 Jul;52(7):809-816. doi: 10.1002/eat.23081. Epub 2019 Apr 12.
• [16] Mucin-producing hepatocellular carcinoma without morphological features of biliary differentiation: A case report.Medicine (Baltimore). 2018 Sep;97(36):e12159. doi: 10.1097/MD.0000000000012159.
• [17] Importance of psychiatric examination in predictive genetic testing for Huntington disease.Neurol Neurochir Pol. 2013 Nov-Dec;47(6):534-41. doi: 10.5114/ninp.2013.39070.
• [18] Specification of hematopoietic and vascular development by the bHLH transcription factor SCL without direct DNA binding.Development. 1999 Oct;126(20):4603-15. doi: 10.1242/dev.126.20.4603.
• [19] Mucin staining is of limited value in addition to basic immunohistochemical analyses in the diagnostics of non-small cell lung cancer.Sci Rep. 2019 Feb 4;9(1):1319. doi: 10.1038/s41598-018-37722-0.
• [20] Clinical and psychological outcome after surgery for lumbar spinal stenosis: A prospective observational study with analysis of prognostic factors.Neurol Neurochir Pol. 2018 Jan-Feb;52(1):70-74. doi: 10.1016/j.pjnns.2017.12.002. Epub 2017 Dec 8.
• [21] An overview of which health domains to consider and when to apply them in measurement-based care for depression and anxiety disorders.Nord J Psychiatry. 2018 Jul;72(5):367-373. doi: 10.1080/08039488.2018.1465592. Epub 2018 May 1.
• [22] Validation of the Italian version of the Laval questionnaire: health-related quality of life in subjects with obesity.Health Qual Life Outcomes. 2017 May 15;15(1):101. doi: 10.1186/s12955-017-0671-3.
• [23] Renal cell carcinoma with areas mimicking renal angiomyoadenomatous tumor/clear cell papillary renal cell carcinoma.Hum Pathol. 2013 Jul;44(7):1412-20. doi: 10.1016/j.humpath.2012.11.019. Epub 2013 Feb 21.
• [24] The prevalence of psychological distress in Parkinson's disease patients: The brief symptom inventory (BSI-18) versus the Hopkins symptom checklist (SCL-90-R).Prog Neuropsychopharmacol Biol Psychiatry. 2019 Jan 10;88:96-101. doi: 10.1016/j.pnpbp.2018.07.012. Epub 2018 Jul 12.
• [25] Interpreter-mediated psychotherapy with trauma-affected refugees - A retrospective cohort study.Psychiatry Res. 2019 Jan;271:684-692. doi: 10.1016/j.psychres.2018.12.058. Epub 2018 Dec 10.
• [26] Expression of cytokeratin 7 as a histological marker of cholestasis and stages of primary biliary cirrhosis.Medicina (Kaunas). 2011;47(1):31-8.
• [27] Could EMA and cytokeratin 7 be useful in distinguishing tricholemmal carcinoma from clear-cell squamous cell carcinoma? A case series from our department and a brief review of the literature.Acta Histochem. 2019 Aug;121(6):765-767. doi: 10.1016/j.acthis.2019.06.002. Epub 2019 Jun 21.
• [28] Identification of novel lncRNAs regulated by the TAL1 complex in T-cell acute lymphoblastic leukemia.Leukemia. 2018 Oct;32(10):2138-2151. doi: 10.1038/s41375-018-0110-4. Epub 2018 Mar 26.
• [29] SCL/TAL1: a multifaceted regulator from blood development to disease.Blood. 2017 Apr 13;129(15):2051-2060. doi: 10.1182/blood-2016-12-754051. Epub 2017 Feb 8.
• [30] Genome-Wide Association Study Identifies Novel Loci Associated With Diisocyanate-Induced Occupational Asthma.Toxicol Sci. 2015 Jul;146(1):192-201. doi: 10.1093/toxsci/kfv084. Epub 2015 Apr 26.
• [31] Identification of relevant prognostic values of cytokeratin 20 and cytokeratin 7 expressions in lung cancer.Biosci Rep. 2017 Nov 6;37(6):BSR20171086. doi: 10.1042/BSR20171086. Print 2017 Dec 22.
• [32] Differential gene expression identifies KRT7 and MUC1 as potential metastasis-specific targets in sarcoma.Cancer Manag Res. 2019 Sep 9;11:8209-8218. doi: 10.2147/CMAR.S218676. eCollection 2019.
• [33] Extensive surface phenotyping of alveolar macrophages in interstitial lung disease.Clin Immunol. 2000 Jan;94(1):33-41. doi: 10.1006/clim.1999.4803.
• [34] Absence of SCL mutations in myeloid malignancies.Br J Haematol. 2003 Feb;120(3):482-3. doi: 10.1046/j.1365-2141.2003.04122.x.
• [35] Paget's disease of the nipple in a Her2-positive breast cancer xenograft model.Breast Cancer Res Treat. 2020 Feb;179(3):577-584. doi: 10.1007/s10549-019-05490-8. Epub 2019 Nov 13.
• [36] Portal, but not lobular, macrophages express matrix metalloproteinase-9: association with the ductular reaction and fibrosis in chronic hepatitis C.Liver Int. 2013 Apr;33(4):569-79. doi: 10.1111/liv.12050. Epub 2012 Dec 13.
• [37] Psychiatric symptoms in migraine patients and their attitudes towards psychological support on stigmatization.J Clin Neurosci. 2019 Apr;62:180-183. doi: 10.1016/j.jocn.2018.11.035. Epub 2018 Nov 22.
• [38] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [39] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [40] Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
• [41] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [42] Profile of estrogen-responsive genes in an estrogen-specific mammary gland outgrowth model. Mol Reprod Dev. 2009 Aug;76(8):733-50. doi: 10.1002/mrd.21041.
• [43] Proteomics-based identification of differentially abundant proteins from human keratinocytes exposed to arsenic trioxide. J Proteomics Bioinform. 2014 Jul;7(7):166-178.
• [44] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [45] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [46] Progestins regulate genes that can elicit both proliferative and antiproliferative effects in breast cancer cells. Oncol Rep. 2008 Jun;19(6):1627-34.
• [47] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [48] Cannabidiol Activates Neuronal Precursor Genes in Human Gingival Mesenchymal Stromal Cells. J Cell Biochem. 2017 Jun;118(6):1531-1546. doi: 10.1002/jcb.25815. Epub 2016 Dec 29.
• [49] Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
• [50] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [51] Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
• [52] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [53] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [54] Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
• [55] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [56] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [57] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [58] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [59] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [60] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.
• [61] Toxicity of smoke extracts towards A549 lung cells: role of acrolein and suppression by carbonyl scavengers. Chem Biol Interact. 2010 Feb 12;183(3):416-24.
• [62] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
• [63] Phthalates stimulate the epithelial to mesenchymal transition through an HDAC6-dependent mechanism in human breast epithelial stem cells. Toxicol Sci. 2012 Aug;128(2):365-76. doi: 10.1093/toxsci/kfs163. Epub 2012 May 2.
• [64] Gene expression analysis using human cancer xenografts to identify novel predictive marker genes for the efficacy of 5-fluorouracil-based drugs. Cancer Sci. 2006 Jun;97(6):510-22. doi: 10.1111/j.1349-7006.2006.00204.x.