Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLWCY9T)

• DOT Name: Peroxiredoxin-2 (PRDX2)
• Synonyms: EC 1.11.1.24; Natural killer cell-enhancing factor B; NKEF-B; PRP; Thiol-specific antioxidant protein; TSA; Thioredoxin peroxidase 1; Thioredoxin-dependent peroxide reductase 1; Thioredoxin-dependent peroxiredoxin 2
• Gene Name: PRDX2
• Related Disease:
  Carcinoma
  Tendinopathy
  Advanced cancer
  Asbestosis
  Bernard-Soulier syndrome
  Breast cancer
  Carcinoma of esophagus
  Chondrosarcoma
  Colorectal carcinoma
  Creutzfeldt Jacob disease
  Cutaneous leishmaniasis
  Diphtheria
  Esophageal cancer
  Gerstmann-Straussler-Scheinker syndrome
  Hemolytic anemia
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Influenza
  Keloid
  Knee osteoarthritis
  Melanoma
  Myeloid leukaemia
  Neoplasm
  Neoplasm of esophagus
  Non-small-cell lung cancer
  Osteoarthritis
  Osteosarcoma
  Parkinson disease
  Prion disease
  Prostate carcinoma
  Scrub typhus
  Prostate cancer
  Undifferentiated carcinoma
  Breast carcinoma
  Colon cancer
  Colon carcinoma
  Gastric cancer
  Lung cancer
  Lung carcinoma
  Neuroblastoma
  Prostate neoplasm
  Stomach cancer
• UniProt ID: PRDX2_HUMAN
• PDB ID: 1QMV; 5B8A; 5B8B; 5IJT; 7KIZ; 7KJ0; 7KJ1
• EC Number: 1.11.1.24
• Pfam ID: PF10417 ; PF00578
• Sequence:
  MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSN
  RAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKT
  DEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS
  DTIKPNVDDSKEYFSKHN
• Function: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).
• Reactome Pathway:
  TP53 Regulates Metabolic Genes (R-HSA-5628897)
  Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models (R-HSA-8862803)
  Detoxification of Reactive Oxygen Species (R-HSA-3299685)

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma	DISH9F1N	Definitive	Biomarker	[1]
Tendinopathy	DISJH7UX	Definitive	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Asbestosis	DISO5XCZ	Strong	Biomarker	[4]
Bernard-Soulier syndrome	DISLD1FU	Strong	Biomarker	[5]
Breast cancer	DIS7DPX1	Strong	Biomarker	[6]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[7]
Chondrosarcoma	DIS4I7JB	Strong	Biomarker	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[9]
Creutzfeldt Jacob disease	DISCB6RX	Strong	Genetic Variation	[10]
Cutaneous leishmaniasis	DISRK7TS	Strong	Biomarker	[11]
Diphtheria	DISZWM55	Strong	Genetic Variation	[12]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[7]
Gerstmann-Straussler-Scheinker syndrome	DISIO6KC	Strong	Genetic Variation	[13]
Hemolytic anemia	DIS803XQ	Strong	Biomarker	[14]
Hepatitis B virus infection	DISLQ2XY	Strong	Genetic Variation	[12]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[3]
Influenza	DIS3PNU3	Strong	Biomarker	[12]
Keloid	DISV09JY	Strong	Biomarker	[15]
Knee osteoarthritis	DISLSNBJ	Strong	Biomarker	[16]
Melanoma	DIS1RRCY	Strong	Biomarker	[17]
Myeloid leukaemia	DISMN944	Strong	Therapeutic	[18]
Neoplasm	DISZKGEW	Strong	Biomarker	[19]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[7]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[20]
Osteoarthritis	DIS05URM	Strong	Biomarker	[21]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[22]
Parkinson disease	DISQVHKL	Strong	Altered Expression	[23]
Prion disease	DISOUMB0	Strong	Genetic Variation	[24]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[25]
Scrub typhus	DISRXONX	Strong	Biomarker	[26]
Prostate cancer	DISF190Y	moderate	Biomarker	[25]
Undifferentiated carcinoma	DISIAZST	Disputed	Biomarker	[1]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[6]
Colon cancer	DISVC52G	Limited	Biomarker	[27]
Colon carcinoma	DISJYKUO	Limited	Biomarker	[27]
Gastric cancer	DISXGOUK	Limited	Biomarker	[28]
Lung cancer	DISCM4YA	Limited	Biomarker	[29]
Lung carcinoma	DISTR26C	Limited	Biomarker	[29]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[30]
Prostate neoplasm	DISHDKGQ	Limited	Biomarker	[31]
Stomach cancer	DISKIJSX	Limited	Biomarker	[28]

This DOT Affected the Drug Response of 6 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Peroxiredoxin-2 (PRDX2) decreases the response to substance of Tretinoin.	[18]
Doxorubicin	DMVP5YE	Approved	Peroxiredoxin-2 (PRDX2) decreases the response to substance of Doxorubicin.	[22]
Methotrexate	DM2TEOL	Approved	Peroxiredoxin-2 (PRDX2) decreases the response to substance of Methotrexate.	[22]
Paclitaxel	DMLB81S	Approved	Peroxiredoxin-2 (PRDX2) affects the response to substance of Paclitaxel.	[64]
Mitoxantrone	DMM39BF	Approved	Peroxiredoxin-2 (PRDX2) affects the response to substance of Mitoxantrone.	[64]
Deoxycholic acid	DM3GYAL	Approved	Peroxiredoxin-2 (PRDX2) decreases the response to substance of Deoxycholic acid.	[65]

This DOT Affected the Regulation of Drug Effects of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Peroxiredoxin-2 (PRDX2) affects the metabolism of Arsenic.	[63]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Peroxiredoxin-2 (PRDX2).	[32]
DNCB	DMDTVYC	Phase 2	DNCB increases the oxidation of Peroxiredoxin-2 (PRDX2).	[54]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Peroxiredoxin-2 (PRDX2).	[57]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Peroxiredoxin-2 (PRDX2).	[33]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Peroxiredoxin-2 (PRDX2).	[34]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Peroxiredoxin-2 (PRDX2).	[35]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Peroxiredoxin-2 (PRDX2).	[36]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Peroxiredoxin-2 (PRDX2).	[37]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Peroxiredoxin-2 (PRDX2).	[38]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Peroxiredoxin-2 (PRDX2).	[39]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Peroxiredoxin-2 (PRDX2).	[40]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Peroxiredoxin-2 (PRDX2).	[41]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Peroxiredoxin-2 (PRDX2).	[42]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Peroxiredoxin-2 (PRDX2).	[43]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Peroxiredoxin-2 (PRDX2).	[44]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Peroxiredoxin-2 (PRDX2).	[45]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone affects the expression of Peroxiredoxin-2 (PRDX2).	[46]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Peroxiredoxin-2 (PRDX2).	[47]
Cocaine	DMSOX7I	Approved	Cocaine decreases the expression of Peroxiredoxin-2 (PRDX2).	[48]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of Peroxiredoxin-2 (PRDX2).	[49]
Etretinate	DM2CZFA	Approved	Etretinate increases the expression of Peroxiredoxin-2 (PRDX2).	[50]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Peroxiredoxin-2 (PRDX2).	[52]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Peroxiredoxin-2 (PRDX2).	[53]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Peroxiredoxin-2 (PRDX2).	[55]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Peroxiredoxin-2 (PRDX2).	[56]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Peroxiredoxin-2 (PRDX2).	[52]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Peroxiredoxin-2 (PRDX2).	[58]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Peroxiredoxin-2 (PRDX2).	[59]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Peroxiredoxin-2 (PRDX2).	[39]
Forskolin	DM6ITNG	Investigative	Forskolin decreases the expression of Peroxiredoxin-2 (PRDX2).	[60]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Resveratrol	DM3RWXL	Phase 3	Resveratrol affects the secretion of Peroxiredoxin-2 (PRDX2).	[51]

References

• [1] Global gene expression profiling of chemically induced rat mammary gland carcinomas and adenomas.Toxicol Pathol. 2005;33(7):768-75. doi: 10.1080/01926230500437027.
• [2] Intratendon delivery of leukocyte-rich platelet-rich plasma at early stage promotes tendon repair in a rabbit Achilles tendinopathy model.J Tissue Eng Regen Med. 2020 Mar;14(3):452-463. doi: 10.1002/term.3006. Epub 2019 Dec 23.
• [3] Peroxiredoxin2 downregulation enhances hepatocellular carcinoma proliferation and migration, and is associated with unfavorable prognosis in patients.Oncol Rep. 2019 Mar;41(3):1539-1548. doi: 10.3892/or.2019.6977. Epub 2019 Jan 22.
• [4] Peroxiredoxins and tropomyosins as plasma biomarkers for lung cancer and asbestos exposure.Lung Cancer. 2012 Aug;77(2):450-9. doi: 10.1016/j.lungcan.2012.03.024. Epub 2012 Apr 24.
• [5] Fibrin polymerization is crucial for thrombin generation in platelet-rich plasma in a VWF-GPIb-dependent process, defective in Bernard-Soulier syndrome.J Thromb Haemost. 2004 Jan;2(1):170-6. doi: 10.1111/j.1538-7836.2004.00558.x.
• [6] Identification of potential breast cancer markers in nipple discharge by protein profile analysis using two-dimensional nano-liquid chromatography/nanoelectrospray ionization-mass spectrometry.Proteomics Clin Appl. 2016 May;10(5):605-13. doi: 10.1002/prca.201500016. Epub 2016 Apr 26.
• [7] Aberrant hypermethylation-mediated downregulation of antisense lncRNA ZNF667-AS1 and its sense gene ZNF667 correlate with progression and prognosis of esophageal squamous cell carcinoma.Cell Death Dis. 2019 Dec 5;10(12):930. doi: 10.1038/s41419-019-2171-3.
• [8] PRP? significantly decreases the ALDHhigh cancer stem cell population and regulates the aberrant Wnt/catenin pathway in human chondrosarcoma JJ012cells.Oncol Rep. 2019 Jul;42(1):103-114. doi: 10.3892/or.2019.7172. Epub 2019 May 24.
• [9] Morphological, immunohistochemical and molecular features of inflammatory bowel disease associated colorectal carcinoma and associated mucosal lesions - Single institution experience.Pathol Res Pract. 2019 Apr;215(4):730-737. doi: 10.1016/j.prp.2019.01.010. Epub 2019 Jan 11.
• [10] An autopsy case of Creutzfeldt-Jakob disease with a V180I mutation of the PrP gene and Alzheimer-type pathology.Neuropathology. 2010 Apr;30(2):159-64. doi: 10.1111/j.1440-1789.2009.01048.x. Epub 2009 Aug 23.
• [11] Comparative Assessment of Induced Immune Responses Following Intramuscular Immunization with Fusion and Cocktail of LeIF, LACK and TSA Genes Against Cutaneous Leishmaniasis in BALB/c Mice.Arch Immunol Ther Exp (Warsz). 2018 Feb;66(1):55-64. doi: 10.1007/s00005-017-0484-4. Epub 2017 Aug 4.
• [12] Evaluation of a Hexavalent-Pentavalent-Hexavalent Infant Primary Vaccination Series Followed by a Pentavalent Booster Vaccine in Healthy Infants and Toddlers.Pediatr Infect Dis J. 2019 Mar;38(3):317-322. doi: 10.1097/INF.0000000000002231.
• [13] Gerstmann-Strussler-Scheinker disease revisited: accumulation of covalently-linked multimers of internal prion protein fragments.Acta Neuropathol Commun. 2019 May 29;7(1):85. doi: 10.1186/s40478-019-0734-2.
• [14] Global analysis of erythroid cells redox status reveals the involvement of Prdx1 and Prdx2 in the severity of beta thalassemia.PLoS One. 2018 Dec 6;13(12):e0208316. doi: 10.1371/journal.pone.0208316. eCollection 2018.
• [15] Comparative proteomic analysis between normal skin and keloid scar.Br J Dermatol. 2010 Jun;162(6):1302-15. doi: 10.1111/j.1365-2133.2010.09660.x. Epub 2010 Feb 1.
• [16] The use of cellular matrix in symptomatic knee osteoarthritis.Bosn J Basic Med Sci. 2020 May 1;20(2):271-274. doi: 10.17305/bjbms.2019.4205.
• [17] Silencing of Peroxiredoxin 2 and aberrant methylation of 33 CpG islands in putative promoter regions in human malignant melanomas.Cancer Res. 2006 Jun 15;66(12):6080-6. doi: 10.1158/0008-5472.CAN-06-0157.
• [18] Downregulation of topoisomerase IIbeta in myeloid leukemia cell lines leads to activation of apoptosis following all-trans retinoic acid-induced differentiation/growth arrest. Leukemia. 2006 Oct;20(10):1809-18. doi: 10.1038/sj.leu.2404351. Epub 2006 Aug 17.
• [19] Prx2 links ROS homeostasis to stemness of cancer stem cells.Free Radic Biol Med. 2019 Apr;134:260-267. doi: 10.1016/j.freeradbiomed.2019.01.001. Epub 2019 Jan 4.
• [20] MicroRNA-122 negatively associates with peroxiredoxin-II expression in human gefitinib-resistant lung cancer stem cells.Cancer Gene Ther. 2019 Sep;26(9-10):292-304. doi: 10.1038/s41417-018-0050-1. Epub 2018 Oct 19.
• [21] Comparative analysis of conventional and biological treatment in healing of bone disease.Saudi J Biol Sci. 2018 Jan;25(1):162-166. doi: 10.1016/j.sjbs.2017.02.003. Epub 2017 Feb 24.
• [22] Proteomics study of open biopsy samples identifies peroxiredoxin 2 as a predictive biomarker of response to induction chemotherapy in osteosarcoma. J Proteomics. 2013 Oct 8;91:393-404. doi: 10.1016/j.jprot.2013.07.022. Epub 2013 Aug 2.
• [23] Inhibition of HDAC6 increases acetylation of peroxiredoxin1/2 and ameliorates 6-OHDA induced dopaminergic injury.Neurosci Lett. 2017 Sep 29;658:114-120. doi: 10.1016/j.neulet.2017.08.029. Epub 2017 Aug 18.
• [24] PrP(ST), a soluble, protease resistant and truncated PrP form features in the pathogenesis of a genetic prion disease.PLoS One. 2013 Jul 26;8(7):e69583. doi: 10.1371/journal.pone.0069583. Print 2013.
• [25] Peroxiredoxin 2 in the nucleus and cytoplasm distinctly regulates androgen receptor activity in prostate cancer cells.Free Radic Biol Med. 2011 Jul 1;51(1):78-87. doi: 10.1016/j.freeradbiomed.2011.04.001. Epub 2011 Apr 14.
• [26] Analysis of the 56-kDa type specific antigen gene of Orientia tsutsugamushi from northern Vietnam.PLoS One. 2019 Aug 30;14(8):e0221588. doi: 10.1371/journal.pone.0221588. eCollection 2019.
• [27] siPRDX2-elevated DNM3 inhibits the proliferation and metastasis of colon cancer cells via AKT signaling pathway.Cancer Manag Res. 2019 Jun 28;11:5799-5811. doi: 10.2147/CMAR.S193805. eCollection 2019.
• [28] PRDX2 protects against oxidative stress induced by H. pylori and promotes resistance to cisplatin in gastric cancer.Redox Biol. 2020 Jan;28:101319. doi: 10.1016/j.redox.2019.101319. Epub 2019 Sep 5.
• [29] S-nitrosylation of the Peroxiredoxin-2 promotes S-nitrosoglutathione-mediated lung cancer cells apoptosis via AMPK-SIRT1 pathway.Cell Death Dis. 2019 Apr 15;10(5):329. doi: 10.1038/s41419-019-1561-x.
• [30] A SP1/MIZ1/MYCN repression complex recruits HDAC1 at the TRKA and p75NTR promoters and affects neuroblastoma malignancy by inhibiting the cell response to NGF.Cancer Res. 2011 Jan 15;71(2):404-12. doi: 10.1158/0008-5472.CAN-10-2627. Epub 2010 Dec 1.
• [31] Proteome analysis of human androgen-independent prostate cancer cell lines: variable metastatic potentials correlated with vimentin expression.Proteomics. 2007 Jun;7(12):1973-83. doi: 10.1002/pmic.200600643.
• [32] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [33] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [34] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [35] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [36] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [37] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [38] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [39] Quercetin reduces oxidative damage induced by paraquat via modulating expression of antioxidant genes in A549 cells. J Appl Toxicol. 2013 Dec;33(12):1460-7. doi: 10.1002/jat.2812. Epub 2012 Sep 20.
• [40] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [41] Characterization of antioxidant properties of natural killer-enhancing factor-B and induction of its expression by hydrogen peroxide. Toxicol Appl Pharmacol. 1997 Nov;147(1):135-42. doi: 10.1006/taap.1997.8270.
• [42] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [43] Cannabis-induced cytotoxicity in leukemic cell lines: the role of the cannabinoid receptors and the MAPK pathway. Blood. 2005 Feb 1;105(3):1214-21. doi: 10.1182/blood-2004-03-1182. Epub 2004 Sep 28.
• [44] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [45] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [46] Proteomic analysis of human adipose tissue after rosiglitazone treatment shows coordinated changes to promote glucose uptake. Obesity (Silver Spring). 2010 Jan;18(1):27-34. doi: 10.1038/oby.2009.208. Epub 2009 Jun 25.
• [47] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [48] Cytosolic proteomic alterations in the nucleus accumbens of cocaine overdose victims. Mol Psychiatry. 2007 Jan;12(1):55-73. doi: 10.1038/sj.mp.4001914. Epub 2006 Oct 31.
• [49] Protein profile in neuroblastoma cells incubated with S- and R-enantiomers of ibuprofen by iTRAQ-coupled 2-D LC-MS/MS analysis: possible action of induced proteins on Alzheimer's disease. Proteomics. 2008 Apr;8(8):1595-607. doi: 10.1002/pmic.200700556.
• [50] Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
• [51] Calorie restriction-induced changes in the secretome of human adipocytes, comparison with resveratrol-induced secretome effects. Biochim Biophys Acta. 2014 Sep;1844(9):1511-22. doi: 10.1016/j.bbapap.2014.04.023. Epub 2014 May 5.
• [52] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [53] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [54] The thioredoxin reductase inhibitor auranofin triggers apoptosis through a Bax/Bak-dependent process that involves peroxiredoxin 3 oxidation. Biochem Pharmacol. 2008 Oct 30;76(9):1097-109.
• [55] Early changes in proteome levels upon acute deltamethrin exposure in mammalian skin system associated with its neoplastic transformation potential. J Toxicol Sci. 2013;38(4):629-42.
• [56] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [57] Bisphenol-A impairs cellular function and alters DNA methylation of stress pathway genes in first trimester trophoblast cells. Reprod Toxicol. 2018 Dec;82:72-79.
• [58] Formaldehyde induces apoptosis through decreased Prx 2 via p38 MAPK in lung epithelial cells. Toxicology. 2010 May 27;271(3):100-6. doi: 10.1016/j.tox.2010.03.011. Epub 2010 Mar 25.
• [59] Linking site-specific loss of histone acetylation to repression of gene expression by the mycotoxin ochratoxin A. Arch Toxicol. 2018 Feb;92(2):995-1014.
• [60] Apoptotic responses stimulated by the trichloroethylene metabolite S-(1,2-dichlorovinyl)-L-cysteine depend on cell differentiation state in BeWo human trophoblast cells. Toxicol In Vitro. 2023 Feb;86:105514. doi: 10.1016/j.tiv.2022.105514. Epub 2022 Nov 4.
• [61] Downregulation of topoisomerase IIbeta in myeloid leukemia cell lines leads to activation of apoptosis following all-trans retinoic acid-induced differentiation/growth arrest. Leukemia. 2006 Oct;20(10):1809-18. doi: 10.1038/sj.leu.2404351. Epub 2006 Aug 17.
• [62] Proteomics study of open biopsy samples identifies peroxiredoxin 2 as a predictive biomarker of response to induction chemotherapy in osteosarcoma. J Proteomics. 2013 Oct 8;91:393-404. doi: 10.1016/j.jprot.2013.07.022. Epub 2013 Aug 2.
• [63] Arsenic metabolism is influenced by polymorphisms in genes involved in one-carbon metabolism and reduction reactions. Mutat Res. 2009 Jul 10;667(1-2):4-14. doi: 10.1016/j.mrfmmm.2008.07.003. Epub 2008 Jul 17.
• [64] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [65] Development and molecular characterization of HCT-116 cell lines resistant to the tumor promoter and multiple stress-inducer, deoxycholate. Carcinogenesis. 2002 Dec;23(12):2063-80. doi: 10.1093/carcin/23.12.2063.