Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMCN6D3)

DOT Name Oligodendrocyte transcription factor 2 (OLIG2)
Synonyms Oligo2; Class B basic helix-loop-helix protein 1; bHLHb1; Class E basic helix-loop-helix protein 19; bHLHe19; Protein kinase C-binding protein 2; Protein kinase C-binding protein RACK17
Gene Name OLIG2
Related Disease
Acute myelogenous leukaemia ( )
Central nervous system neoplasm ( )
Intellectual disability ( )
Adult glioblastoma ( )
Advanced cancer ( )
Anaplastic astrocytoma ( )
Anorexia nervosa cachexia ( )
Astrocytoma ( )
Autism spectrum disorder ( )
Cerebral palsy ( )
Cognitive impairment ( )
Familial adenomatous polyposis ( )
Glioblastoma multiforme ( )
Glioma ( )
leukaemia ( )
Leukemia ( )
Lung neoplasm ( )
Malignant glioma ( )
Mental disorder ( )
Metastatic malignant neoplasm ( )
Nervous system inflammation ( )
Non-insulin dependent diabetes ( )
Psychotic disorder ( )
Substance abuse ( )
T-cell acute lymphoblastic leukaemia ( )
Tourette syndrome ( )
X-linked intellectual disability ( )
Ependymoma ( )
Neurofibromatosis type 1 ( )
Rhabdomyosarcoma ( )
Alzheimer disease ( )
Amyotrophic lateral sclerosis ( )
Brain cancer ( )
Breast neoplasm ( )
Lung cancer ( )
Lung carcinoma ( )
Melanoma ( )
Obsessive compulsive disorder ( )
Type-1 diabetes ( )
UniProt ID
OLIG2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00010
Sequence
MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMG
SAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKR
MHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH
HAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSS
ASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQV
PPPHHHVSAMGAGSLPRLTSDAK
Function
Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. Functions together with ZNF488 to promote oligodendrocyte differentiation. Cooperates with OLIG1 to establish the pMN domain of the embryonic neural tube. Antagonist of V2 interneuron and of NKX2-2-induced V3 interneuron development.
Tissue Specificity Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas highly variable.

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute myelogenous leukaemia DISCSPTN Definitive Biomarker [1]
Central nervous system neoplasm DISFC18W Definitive Biomarker [2]
Intellectual disability DISMBNXP Definitive Biomarker [3]
Adult glioblastoma DISVP4LU Strong Biomarker [4]
Advanced cancer DISAT1Z9 Strong Biomarker [5]
Anaplastic astrocytoma DISSBE0K Strong Biomarker [6]
Anorexia nervosa cachexia DISFO5RQ Strong Genetic Variation [7]
Astrocytoma DISL3V18 Strong Biomarker [8]
Autism spectrum disorder DISXK8NV Strong Genetic Variation [9]
Cerebral palsy DIS82ODL Strong Genetic Variation [10]
Cognitive impairment DISH2ERD Strong Biomarker [11]
Familial adenomatous polyposis DISW53RE Strong Biomarker [12]
Glioblastoma multiforme DISK8246 Strong Altered Expression [4]
Glioma DIS5RPEH Strong Genetic Variation [13]
leukaemia DISS7D1V Strong Altered Expression [14]
Leukemia DISNAKFL Strong Altered Expression [14]
Lung neoplasm DISVARNB Strong Altered Expression [15]
Malignant glioma DISFXKOV Strong Biomarker [16]
Mental disorder DIS3J5R8 Strong Genetic Variation [17]
Metastatic malignant neoplasm DIS86UK6 Strong Altered Expression [18]
Nervous system inflammation DISB3X5A Strong Biomarker [19]
Non-insulin dependent diabetes DISK1O5Z Strong Altered Expression [20]
Psychotic disorder DIS4UQOT Strong Genetic Variation [21]
Substance abuse DIS327VW Strong Altered Expression [22]
T-cell acute lymphoblastic leukaemia DIS17AI2 Strong Altered Expression [23]
Tourette syndrome DISX9D54 Strong Biomarker [24]
X-linked intellectual disability DISYJBY3 Strong Biomarker [25]
Ependymoma DISUMRNZ moderate Biomarker [8]
Neurofibromatosis type 1 DIS53JH9 moderate Biomarker [26]
Rhabdomyosarcoma DISNR7MS moderate Altered Expression [27]
Alzheimer disease DISF8S70 Limited Biomarker [21]
Amyotrophic lateral sclerosis DISF7HVM Limited Biomarker [28]
Brain cancer DISBKFB7 Limited Altered Expression [5]
Breast neoplasm DISNGJLM Limited Altered Expression [23]
Lung cancer DISCM4YA Limited Biomarker [29]
Lung carcinoma DISTR26C Limited Biomarker [29]
Melanoma DIS1RRCY Limited Altered Expression [23]
Obsessive compulsive disorder DIS1ZMM2 Limited Biomarker [30]
Type-1 diabetes DIS7HLUB Limited Genetic Variation [31]
------------------------------------------------------------------------------------
⏷ Show the Full List of 39 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Oligodendrocyte transcription factor 2 (OLIG2). [32]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Oligodendrocyte transcription factor 2 (OLIG2). [33]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Oligodendrocyte transcription factor 2 (OLIG2). [34]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Oligodendrocyte transcription factor 2 (OLIG2). [35]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Oligodendrocyte transcription factor 2 (OLIG2). [36]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Oligodendrocyte transcription factor 2 (OLIG2). [33]
Colchicine DM2POTE Approved Colchicine decreases the expression of Oligodendrocyte transcription factor 2 (OLIG2). [34]
Hydroxyurea DMOQVU9 Approved Hydroxyurea decreases the expression of Oligodendrocyte transcription factor 2 (OLIG2). [34]
Sulfadiazine DMTW3R8 Approved Sulfadiazine decreases the expression of Oligodendrocyte transcription factor 2 (OLIG2). [34]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Oligodendrocyte transcription factor 2 (OLIG2). [34]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Oligodendrocyte transcription factor 2 (OLIG2). [38]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Oligodendrocyte transcription factor 2 (OLIG2). [34]
Glyphosate DM0AFY7 Investigative Glyphosate decreases the expression of Oligodendrocyte transcription factor 2 (OLIG2). [34]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Oligodendrocyte transcription factor 2 (OLIG2). [37]
------------------------------------------------------------------------------------

References

1 Evaluating the impact of genetic and epigenetic aberrations on survival and response in acute myeloid leukemia patients receiving epigenetic therapy.Ann Hematol. 2017 Apr;96(4):559-565. doi: 10.1007/s00277-016-2912-7. Epub 2017 Jan 5.
2 OLIG2 is a useful immunohistochemical marker in differential diagnosis of clear cell primary CNS neoplasms.Histopathology. 2007 Feb;50(3):365-70. doi: 10.1111/j.1365-2559.2007.02614.x.
3 Dosage Counts: Correcting Trisomy-21-Related Phenotypes in Human Organoids and Xenografts.Cell Stem Cell. 2019 Jun 6;24(6):835-836. doi: 10.1016/j.stem.2019.05.009.
4 Prognostic impact of glioblastoma stem cell markers OLIG2 and CCND2.Cancer Med. 2020 Feb;9(3):1069-1078. doi: 10.1002/cam4.2592. Epub 2019 Sep 30.
5 Molecular mechanisms of OLIG2 transcription factor in brain cancer.Oncotarget. 2016 Aug 16;7(33):53074-53101. doi: 10.18632/oncotarget.10628.
6 Candidate genes for the progression of malignant gliomas identified by microarray analysis.Neurosurg Rev. 2008 Jan;31(1):83-9; discussion 89-90. doi: 10.1007/s10143-007-0107-3. Epub 2007 Oct 5.
7 Common genetic background in anorexia nervosa and obsessive compulsive disorder: preliminary results from an association study.J Psychiatr Res. 2013 Jun;47(6):747-54. doi: 10.1016/j.jpsychires.2012.12.015. Epub 2013 Jan 19.
8 SOX10 and Olig2 as negative markers for the diagnosis of ependymomas: An immunohistochemical study of 98 glial tumors.Histol Histopathol. 2016 Jan;31(1):95-102. doi: 10.14670/HH-11-654. Epub 2015 Aug 19.
9 Integrative analysis of shared genetic pathogenesis by autism spectrum disorder and obsessive-compulsive disorder.Biosci Rep. 2019 Dec 20;39(12):BSR20191942. doi: 10.1042/BSR20191942.
10 Variants of the OLIG2 Gene are Associated with Cerebral Palsy in Chinese Han Infants with Hypoxic-Ischemic Encephalopathy.Neuromolecular Med. 2019 Mar;21(1):75-84. doi: 10.1007/s12017-018-8510-1. Epub 2018 Sep 3.
11 Myelin Deficits Caused by Olig2 Deficiency Lead to Cognitive Dysfunction and Increase Vulnerability to Social Withdrawal in Adult Mice.Neurosci Bull. 2020 Apr;36(4):419-426. doi: 10.1007/s12264-019-00449-7. Epub 2019 Nov 22.
12 Intranasal delivery of SDF-1-preconditioned bone marrow mesenchymal cells improves remyelination in the cuprizone-induced mouse model of multiple sclerosis.Cell Biol Int. 2020 Feb;44(2):499-511. doi: 10.1002/cbin.11250. Epub 2019 Nov 1.
13 Low FoxG1 and high Olig-2 labelling indices define a prognostically favourable subset in isocitrate dehydrogenase (IDH)-mutant gliomas.Neuropathol Appl Neurobiol. 2018 Feb;44(2):207-223. doi: 10.1111/nan.12447. Epub 2017 Nov 23.
14 The oligodendrocyte lineage transcription factor 2 (OLIG2) is epigenetically regulated in acute myeloid leukemia.Exp Hematol. 2017 Nov;55:76-85.e3. doi: 10.1016/j.exphem.2017.07.009. Epub 2017 Jul 28.
15 Global identification of genes targeted by DNMT3b for epigenetic silencing in lung cancer.Oncogene. 2015 Jan 29;34(5):621-30. doi: 10.1038/onc.2013.580. Epub 2014 Jan 27.
16 Harnessing OLIG2 function in tumorigenicity and plasticity to target malignant gliomas.Cell Cycle. 2017 Sep 17;16(18):1654-1660. doi: 10.1080/15384101.2017.1361062. Epub 2017 Aug 14.
17 Risk variant of oligodendrocyte lineage transcription factor 2 is associated with reduced white matter integrity.Hum Brain Mapp. 2013 Sep;34(9):2025-31. doi: 10.1002/hbm.22045. Epub 2012 Apr 16.
18 OLIG2 as a specific marker of oligodendroglial tumour cells.Lancet. 2001 Jul 28;358(9278):298-300. doi: 10.1016/S0140-6736(01)05499-X.
19 Therapeutic Potential of Pien Tze Huang on Experimental Autoimmune Encephalomyelitis Rat.J Immunol Res. 2018 Feb 27;2018:2952471. doi: 10.1155/2018/2952471. eCollection 2018.
20 Presence of White Matter Lesions Associated with Diabetes-Associated Cognitive Decline in Male Rat Models of Pre-Type 2 Diabetes.Med Sci Monit. 2019 Dec 18;25:9679-9689. doi: 10.12659/MSM.918557.
21 Evidence that variation in the oligodendrocyte lineage transcription factor 2 (OLIG2) gene is associated with psychosis in Alzheimer's disease.Neurosci Lett. 2009 Sep 11;461(1):54-9. doi: 10.1016/j.neulet.2009.05.051. Epub 2009 May 27.
22 Expression of oligodendrocyte-associated genes in dorsolateral prefrontal cortex of patients with schizophrenia.Schizophr Res. 2008 Jan;98(1-3):129-38. doi: 10.1016/j.schres.2007.09.032. Epub 2007 Oct 26.
23 OLIG2 (BHLHB1), a bHLH transcription factor, contributes to leukemogenesis in concert with LMO1.Cancer Res. 2005 Aug 15;65(16):7151-8. doi: 10.1158/0008-5472.CAN-05-1400.
24 A genetic family-based association study of OLIG2 in obsessive-compulsive disorder.Arch Gen Psychiatry. 2007 Feb;64(2):209-14. doi: 10.1001/archpsyc.64.2.209.
25 Low-grade neuroepithelial tumor: Unusual presentation in an adult without history of seizures.Neuropathology. 2018 Oct;38(5):557-560. doi: 10.1111/neup.12504. Epub 2018 Jul 26.
26 The cell of origin dictates the temporal course of neurofibromatosis-1 (Nf1) low-grade glioma formation.Oncotarget. 2017 Jul 18;8(29):47206-47215. doi: 10.18632/oncotarget.17589.
27 OLIG2 is a novel immunohistochemical marker associated with the presence of PAX3/7-FOXO1 translocation in rhabdomyosarcomas.Diagn Pathol. 2019 Sep 7;14(1):103. doi: 10.1186/s13000-019-0883-4.
28 Human motor neurons generated from neural stem cells delay clinical onset and prolong life in ALS mouse model.PLoS One. 2014 May 20;9(5):e97518. doi: 10.1371/journal.pone.0097518. eCollection 2014.
29 Aerosolizable gold nano-in-micro dry powder formulations for theragnosis and lung delivery.Int J Pharm. 2017 Mar 15;519(1-2):240-249. doi: 10.1016/j.ijpharm.2017.01.032. Epub 2017 Jan 19.
30 OLIG2 gene polymorphisms are associated with nasty, unpleasant and uncontrollable thoughts in obsessive-compulsive disorder.J Clin Neurosci. 2019 Dec;70:202-207. doi: 10.1016/j.jocn.2019.08.050. Epub 2019 Aug 17.
31 Fine mapping of a region on chromosome 21q21.11-q22.3 showing linkage to type 1 diabetes.J Med Genet. 2005 Jan;42(1):17-25. doi: 10.1136/jmg.2004.022004.
32 Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
33 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
34 Establishment of a 13 genes-based molecular prediction score model to discriminate the neurotoxic potential of food relevant-chemicals. Toxicol Lett. 2022 Feb 1;355:1-18. doi: 10.1016/j.toxlet.2021.10.013. Epub 2021 Nov 5.
35 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
36 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
37 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
38 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.