Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN0XL3W)

• DOT Name: Lysosome-associated membrane glycoprotein 3 (LAMP3)
• Synonyms: LAMP-3; Lysosomal-associated membrane protein 3; DC-lysosome-associated membrane glycoprotein; DC LAMP; Protein TSC403; CD antigen CD208
• Gene Name: LAMP3
• Related Disease:
  Lung adenocarcinoma
  Melanoma
  Respiratory syncytial virus infection
  Tuberculosis
  African trypanosomiasis
  Bipolar disorder
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Brucellosis
  Carcinoma of esophagus
  Coeliac disease
  Danon disease
  Dengue
  Epithelial ovarian cancer
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Fatty liver disease
  Hepatitis
  Hepatitis A virus infection
  Hepatitis C virus infection
  IgA nephropathy
  Immunodeficiency
  Influenza
  Malaria
  Metastatic malignant neoplasm
  Neoplasm
  Neoplasm of esophagus
  Osteosarcoma
  Ovarian cancer
  Ovarian neoplasm
  Pulmonary disease
  Pulmonary tuberculosis
  Rabies
  rubella
  Schizophrenia
  Wilms tumor
  Adenocarcinoma
  Advanced cancer
  Small lymphocytic lymphoma
  Adenoma
  Cardiomyopathy
  Cervical cancer
  Cervical carcinoma
  Chikungunya virus infection
  Colorectal neoplasm
  Ebola virus infection
  Parkinson disease
• UniProt ID: LAMP3_HUMAN
• PDB ID: 4AKM
• Pfam ID: PF01299
• Sequence:
  MPRQLSAAAALFASLAVILHDGSQMRAKAFPETRDYSQPTAAATVQDIKKPVQQPAKQAP
  HQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPV
  TEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKST
  TGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKA
  EMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEES
  YYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQL
  QAFDFEDDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI
• Function: Lysosomal membrane glycoprotein which plays a role in the unfolded protein response (UPR) that contributes to protein degradation and cell survival during proteasomal dysfunction. Plays a role in the process of fusion of the lysosome with the autophagosome, thereby modulating the autophagic process. Promotes hepatocellular lipogenesis through activation of the PI3K/Akt pathway. May also play a role in dendritic cell function and in adaptive immunity ; (Microbial infection) Plays a positive role in post-entry steps of influenza A virus replication, either virus uncoating, cytosolic transport, or nuclear import of viral components, and promotes nuclear accumulation of influenza nucleoprotein/NP at early stages of viral infection; (Microbial infection) Supports the FURIN-mediated cleavage of mumps virus fusion protein F by interacting with both FURIN and the unprocessed form but not the processed form of the viral protein F; (Microbial infection) Promotes the intracellular proliferation of Salmonella typhimuium.
• Tissue Specificity: Detected in tonsil interdigitating dendritic cells, in spleen, lymph node, Peyer's patches in the small instestine, in thymus medulla and in B-cells (at protein level). Expressed in lymphoid organs and dendritic cells. Expressed in lung. Up-regulated in carcinomas of the esophagus, colon, rectum, ureter, stomach, breast, fallopian tube, thyroid and parotid tissues.
• KEGG Pathway: Lysosome (hsa04142)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Definitive	Posttranslational Modification	[1]
Melanoma	DIS1RRCY	Definitive	Biomarker	[2]
Respiratory syncytial virus infection	DIS7FWHY	Definitive	Biomarker	[3]
Tuberculosis	DIS2YIMD	Definitive	Biomarker	[4]
African trypanosomiasis	DISBIXK4	Strong	Biomarker	[5]
Bipolar disorder	DISAM7J2	Strong	Genetic Variation	[6]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[8]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[8]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[8]
Brucellosis	DISEAYGH	Strong	Biomarker	[9]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[10]
Coeliac disease	DISIY60C	Strong	Biomarker	[11]
Danon disease	DIS45YLU	Strong	Genetic Variation	[12]
Dengue	DISKH221	Strong	Biomarker	[13]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[14]
Esophageal cancer	DISGB2VN	Strong	Altered Expression	[10]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[15]
Fatty liver disease	DIS485QZ	Strong	Altered Expression	[16]
Hepatitis	DISXXX35	Strong	Biomarker	[17]
Hepatitis A virus infection	DISUMFQV	Strong	Biomarker	[17]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[18]
IgA nephropathy	DISZ8MTK	Strong	Biomarker	[19]
Immunodeficiency	DIS093I0	Strong	Altered Expression	[20]
Influenza	DIS3PNU3	Strong	Biomarker	[21]
Malaria	DISQ9Y50	Strong	Biomarker	[22]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[23]
Neoplasm	DISZKGEW	Strong	Biomarker	[15]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[10]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[7]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[14]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[14]
Pulmonary disease	DIS6060I	Strong	Altered Expression	[20]
Pulmonary tuberculosis	DIS6FLUM	Strong	Biomarker	[24]
Rabies	DISSC4V5	Strong	Biomarker	[25]
rubella	DISXUI9P	Strong	Biomarker	[26]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[27]
Wilms tumor	DISB6T16	Strong	Altered Expression	[28]
Adenocarcinoma	DIS3IHTY	moderate	Biomarker	[29]
Advanced cancer	DISAT1Z9	moderate	Genetic Variation	[30]
Small lymphocytic lymphoma	DIS30POX	moderate	Biomarker	[31]
Adenoma	DIS78ZEV	Limited	Altered Expression	[32]
Cardiomyopathy	DISUPZRG	Limited	Biomarker	[12]
Cervical cancer	DISFSHPF	Limited	Altered Expression	[33]
Cervical carcinoma	DIST4S00	Limited	Altered Expression	[33]
Chikungunya virus infection	DISDXEHY	Limited	Biomarker	[34]
Colorectal neoplasm	DISR1UCN	Limited	Altered Expression	[32]
Ebola virus infection	DISJAVM1	Limited	Biomarker	[35]
Parkinson disease	DISQVHKL	Limited	Altered Expression	[36]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[37]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[38]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[39]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[40]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[41]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[42]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[43]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[44]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[43]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[43]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[45]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate decreases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[46]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[47]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[48]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[49]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[50]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[52]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[53]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[43]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[43]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[54]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[55]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[56]
Daidzein	DMRFTJX	Investigative	Daidzein decreases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[43]
N-nonylphenol	DMH3OUX	Investigative	N-nonylphenol decreases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[43]
propylpyrazoletriol	DMTCP8K	Investigative	propylpyrazoletriol decreases the expression of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[43]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Lysosome-associated membrane glycoprotein 3 (LAMP3).	[51]

References

• [1] Methylation-specific loop-mediated isothermal amplification for detecting hypermethylated DNA in simplex and multiplex formats.Clin Chem. 2010 Aug;56(8):1287-96. doi: 10.1373/clinchem.2010.143545. Epub 2010 Jun 15.
• [2] Melanoma LAMP-2C Modulates Tumor Growth and Autophagy.Front Cell Dev Biol. 2018 Aug 29;6:101. doi: 10.3389/fcell.2018.00101. eCollection 2018.
• [3] Diagnosis of human respiratory syncytial virus infection using reverse transcription loop-mediated isothermal amplification.J Virol Methods. 2007 Jan;139(1):78-84. doi: 10.1016/j.jviromet.2006.09.014. Epub 2006 Oct 18.
• [4] The human lung mucosa drives differential Mycobacterium tuberculosis infection outcome in the alveolar epithelium.Mucosal Immunol. 2019 May;12(3):795-804. doi: 10.1038/s41385-019-0156-2. Epub 2019 Mar 7.
• [5] Illuminating the Prevalence of Trypanosoma brucei s.l. in Glossina Using LAMP as a Tool for Xenomonitoring.PLoS Negl Trop Dis. 2016 Feb 18;10(2):e0004441. doi: 10.1371/journal.pntd.0004441. eCollection 2016 Feb.
• [6] Genome-wide association study identifies SESTD1 as a novel risk gene for lithium-responsive bipolar disorder.Mol Psychiatry. 2016 Sep;21(9):1290-7. doi: 10.1038/mp.2015.165. Epub 2015 Oct 27.
• [7] LAMP3 plays an oncogenic role in osteosarcoma cells partially by inhibiting TP53.Cell Mol Biol Lett. 2018 Jul 11;23:33. doi: 10.1186/s11658-018-0099-8. eCollection 2018.
• [8] Hypoxic regulation and prognostic value of LAMP3 expression in breast cancer.Cancer. 2011 Aug 15;117(16):3670-81. doi: 10.1002/cncr.25938. Epub 2011 Feb 11.
• [9] Lateral flow biosensor combined with loop-mediated isothermal amplification for simple, rapid, sensitive, and reliable detection of Brucella spp.Infect Drug Resist. 2019 Jul 30;12:2343-2353. doi: 10.2147/IDR.S211644. eCollection 2019.
• [10] Long noncoding RNA HAGLR acts as a microRNA-143-5p sponge to regulate epithelial-mesenchymal transition and metastatic potential in esophageal cancer by regulating LAMP3.FASEB J. 2019 Sep;33(9):10490-10504. doi: 10.1096/fj.201802543RR. Epub 2019 Jul 15.
• [11] Rapid, Loop-Mediated Isothermal Amplification Detection of Celiac Disease Risk Alleles.J Mol Diagn. 2018 May;20(3):307-315. doi: 10.1016/j.jmoldx.2018.01.005. Epub 2018 Feb 17.
• [12] LAMP-2B regulates human cardiomyocyte function by mediating autophagosome-lysosome fusion.Proc Natl Acad Sci U S A. 2019 Jan 8;116(2):556-565. doi: 10.1073/pnas.1808618116. Epub 2018 Dec 24.
• [13] Development and validation of four one-step real-time RT-LAMP assays for specific detection of each dengue virus serotype.PLoS Negl Trop Dis. 2018 May 29;12(5):e0006381. doi: 10.1371/journal.pntd.0006381. eCollection 2018 May.
• [14] LAMP3 expression correlated with poor clinical outcome in human ovarian cancer.Tumour Biol. 2017 Mar;39(3):1010428317695014. doi: 10.1177/1010428317695014.
• [15] Impact of tumor-infiltrating LAMP-3 dendritic cells on the prognosis of esophageal squamous cell carcinoma.Esophagus. 2019 Oct;16(4):333-344. doi: 10.1007/s10388-019-00669-w. Epub 2019 Apr 9.
• [16] SNX10 mediates alcohol-induced liver injury and steatosis by regulating the activation of chaperone-mediated autophagy.J Hepatol. 2018 Jul;69(1):129-141. doi: 10.1016/j.jhep.2018.01.038. Epub 2018 Feb 13.
• [17] Detection of HCV genotypes 1b and 2a by a reverse transcription loop-mediated isothermal amplification assay.J Med Virol. 2017 Jun;89(6):1048-1054. doi: 10.1002/jmv.24747. Epub 2017 Mar 14.
• [18] Hepatitis C Virus NS5A Protein Promotes the Lysosomal Degradation of Hepatocyte Nuclear Factor 1 via Chaperone-Mediated Autophagy.J Virol. 2018 Jun 13;92(13):e00639-18. doi: 10.1128/JVI.00639-18. Print 2018 Jul 1.
• [19] Clinical and immunological implications of increase in CD208+ dendritic cells in tonsils of patients with immunoglobulin A nephropathy.Nephrol Dial Transplant. 2013 Dec;28(12):3004-13. doi: 10.1093/ndt/gft399. Epub 2013 Sep 29.
• [20] Confirmation and further delineation of the 3q26.33-3q27.2 microdeletion syndrome.Eur J Med Genet. 2014 Feb;57(2-3):76-80. doi: 10.1016/j.ejmg.2013.12.007. Epub 2014 Jan 22.
• [21] Evaluation of clinical applicability of reverse transcription-loop-mediated isothermal amplification assay for detection and subtyping of Influenza A viruses.J Virol Methods. 2018 Mar;253:18-25. doi: 10.1016/j.jviromet.2017.12.005. Epub 2017 Dec 15.
• [22] Sample-to-answer palm-sized nucleic acid testing device towards low-cost malaria mass screening.Biosens Bioelectron. 2018 Sep 15;115:83-90. doi: 10.1016/j.bios.2018.05.019. Epub 2018 May 19.
• [23] Rapid detection of metastasis of gastric cancer using reverse transcription loop-mediated isothermal amplification.Int J Cancer. 2007 Mar 1;120(5):1063-9. doi: 10.1002/ijc.22397.
• [24] Diagnostic accuracy of TB-LAMP for pulmonary tuberculosis: a systematic review and meta-analysis.BMC Infect Dis. 2019 Mar 19;19(1):268. doi: 10.1186/s12879-019-3881-y.
• [25] Comparison of Reverse Transcription Loop-Mediated Isothermal Amplification Method with SYBR Green Real-Time RT-PCR and Direct Fluorescent Antibody Test for Diagnosis of Rabies.Jpn J Infect Dis. 2020 Jan 23;73(1):19-25. doi: 10.7883/yoken.JJID.2019.009. Epub 2019 Aug 30.
• [26] Development of an improved RT-LAMP assay for detection of currently circulating rubella viruses.J Virol Methods. 2014 Oct;207:73-7. doi: 10.1016/j.jviromet.2014.06.013. Epub 2014 Jun 24.
• [27] Genome-wide association study identifies five new schizophrenia loci.Nat Genet. 2011 Sep 18;43(10):969-76. doi: 10.1038/ng.940.
• [28] Real-time reverse transcription loop-mediated isothermal amplification for rapid and simple quantification of WT1 mRNA.Clin Biochem. 2009 Apr;42(6):515-20. doi: 10.1016/j.clinbiochem.2009.01.013.
• [29] DC-LAMP stains pulmonary adenocarcinoma with bronchiolar Clara cell differentiation.Hum Pathol. 2007 Feb;38(2):260-8. doi: 10.1016/j.humpath.2006.07.018. Epub 2006 Oct 23.
• [30] Transkingdom network reveals bacterial players associated with cervical cancer gene expression program.PeerJ. 2018 Sep 19;6:e5590. doi: 10.7717/peerj.5590. eCollection 2018.
• [31] Customized oligonucleotide array-based comparative genomic hybridization as a clinical assay for genomic profiling of chronic lymphocytic leukemia.J Mol Diagn. 2009 Jan;11(1):25-34. doi: 10.2353/jmoldx.2009.080037. Epub 2008 Dec 12.
• [32] Expression of lysosome-associated membrane proteins in human colorectal neoplasms and inflammatory diseases.Am J Pathol. 2001 Aug;159(2):449-55. doi: 10.1016/S0002-9440(10)61716-6.
• [33] Overexpression of LAMP3/TSC403/DC-LAMP promotes metastasis in uterine cervical cancer.Cancer Res. 2005 Oct 1;65(19):8640-5. doi: 10.1158/0008-5472.CAN-04-4112.
• [34] Development of a single-tube one-step RT-LAMP assay to detect the Chikungunya virus genome.PLoS Negl Trop Dis. 2018 May 29;12(5):e0006448. doi: 10.1371/journal.pntd.0006448. eCollection 2018 May.
• [35] Rapid detection of all known ebolavirus species by reverse transcription-loop-mediated isothermal amplification (RT-LAMP).J Virol Methods. 2017 Aug;246:8-14. doi: 10.1016/j.jviromet.2017.03.011. Epub 2017 Mar 27.
• [36] Therapeutic potentials of plant iridoids in Alzheimer's and Parkinson's diseases: A review.Eur J Med Chem. 2019 May 1;169:185-199. doi: 10.1016/j.ejmech.2019.03.009. Epub 2019 Mar 8.
• [37] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [38] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [39] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [40] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [41] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [42] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [43] Epigenetic influences of low-dose bisphenol A in primary human breast epithelial cells. Toxicol Appl Pharmacol. 2010 Oct 15;248(2):111-21.
• [44] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [45] Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
• [46] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [47] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [48] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [49] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [50] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [51] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [52] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [53] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [54] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [55] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [56] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.