Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNCPLWE)

• DOT Name: RelA-associated inhibitor (PPP1R13L)
• Synonyms: Inhibitor of ASPP protein; Protein iASPP; NFkB-interacting protein 1; PPP1R13B-like protein
• Gene Name: PPP1R13L
• Related Disease:
  Differentiated thyroid carcinoma
  Lung cancer
  Lung carcinoma
  Non-insulin dependent diabetes
  Parkinson disease
  Prostate cancer
  Prostate carcinoma
  Acute lymphocytic leukaemia
  Acute myelogenous leukaemia
  Adenoma
  Arrhythmogenic right ventricular cardiomyopathy
  Astrocytoma
  Carcinoma
  Cervical cancer
  Cervical carcinoma
  Childhood acute lymphoblastic leukemia
  Colon cancer
  Colon carcinoma
  Dilated cardiomyopathy 1A
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Leukemia
  Liver cirrhosis
  Medullary thyroid gland carcinoma
  Neoplasm
  Non-small-cell lung cancer
  Noonan syndrome with multiple lentigines
  Pancreatic cancer
  Skin disease
  Small lymphocytic lymphoma
  Advanced cancer
  Gastric cancer
  Glioma
  Metastatic malignant neoplasm
  Obesity
  Stomach cancer
  Thyroid gland papillary carcinoma
  Cerebral infarction
  Melanoma
  Neuroblastoma
  Acute leukaemia
  Breast cancer
  Breast carcinoma
  Cardiomyopathy
  Epithelial ovarian cancer
  Ovarian cancer
  Ovarian neoplasm
  Plasma cell myeloma
• UniProt ID: IASPP_HUMAN
• PDB ID: 2VGE; 6DCX; 6HL6; 6RZ3
• Pfam ID: PF12796 ; PF14604
• Sequence:
  MDSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQ
  AGPPSRPPRYSSSSIPEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSPLSPKGRPSS
  PRTPLYLQPDAYGSLDRATSPRPRAFDGAGSSLGRAPSPRPGPGPLRQQGPPTPFDFLGR
  AGSPRGSPLAEGPQAFFPERGPSPRPPATAYDAPASAFGSSLLGSGGSAFAPPLRAQDDL
  TLRRRPPKAWNESDLDVAYEKKPSQTASYERLDVFARPASPSLQLLPWRESSLDGLGGTG
  KDNLTSATLPRNYKVSPLASDRRSDAGSYRRSLGSAGPSGTLPRSWQPVSRIPMPPSSPQ
  PRGAPRQRPIPLSMIFKLQNAFWEHGASRAMLPGSPLFTRAPPPKLQPQPQPQPQPQSQP
  QPQLPPQPQTQPQTPTPAPQHPQQTWPPVNEGPPKPPTELEPEPEIEGLLTPVLEAGDVD
  EGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHK
  KQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPE
  QPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEG
  ITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIF
  ATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFR
  EGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV
• Function: Regulator that plays a central role in regulation of apoptosis and transcription via its interaction with NF-kappa-B and p53/TP53 proteins. Blocks transcription of HIV-1 virus by inhibiting the action of both NF-kappa-B and SP1. Also inhibits p53/TP53 function, possibly by preventing the association between p53/TP53 and ASPP1 or ASPP2, and therefore suppressing the subsequent activation of apoptosis.
• Tissue Specificity: Highly expressed in heart, placenta and prostate. Weakly expressed in brain, liver, skeletal muscle, testis and peripheral blood leukocyte.
• KEGG Pathway:
  NF-kappa B sig.ling pathway (hsa04064)
  p53 sig.ling pathway (hsa04115)
• Reactome Pathway: Regulation of TP53 Activity through Association with Co-factors (R-HSA-6804759)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Differentiated thyroid carcinoma	DIS1V20Y	Definitive	Biomarker	[1]
Lung cancer	DISCM4YA	Definitive	Posttranslational Modification	[2]
Lung carcinoma	DISTR26C	Definitive	Posttranslational Modification	[2]
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Biomarker	[3]
Parkinson disease	DISQVHKL	Definitive	Biomarker	[4]
Prostate cancer	DISF190Y	Definitive	Altered Expression	[5]
Prostate carcinoma	DISMJPLE	Definitive	Altered Expression	[5]
Acute lymphocytic leukaemia	DISPX75S	Strong	Genetic Variation	[6]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[7]
Adenoma	DIS78ZEV	Strong	Genetic Variation	[8]
Arrhythmogenic right ventricular cardiomyopathy	DIS3V2BE	Strong	Biomarker	[9]
Astrocytoma	DISL3V18	Strong	Altered Expression	[10]
Carcinoma	DISH9F1N	Strong	Genetic Variation	[8]
Cervical cancer	DISFSHPF	Strong	Biomarker	[11]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[11]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Genetic Variation	[6]
Colon cancer	DISVC52G	Strong	Biomarker	[12]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[12]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Biomarker	[13]
Hepatitis B virus infection	DISLQ2XY	Strong	Altered Expression	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[15]
Leukemia	DISNAKFL	Strong	Biomarker	[16]
Liver cirrhosis	DIS4G1GX	Strong	Altered Expression	[14]
Medullary thyroid gland carcinoma	DISHBL3K	Strong	Genetic Variation	[17]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[18]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[19]
Noonan syndrome with multiple lentigines	DIS014D0	Strong	Biomarker	[9]
Pancreatic cancer	DISJC981	Strong	Biomarker	[20]
Skin disease	DISDW8R6	Strong	Genetic Variation	[21]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[22]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[23]
Gastric cancer	DISXGOUK	moderate	Altered Expression	[24]
Glioma	DIS5RPEH	moderate	Biomarker	[10]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[1]
Obesity	DIS47Y1K	moderate	Biomarker	[25]
Stomach cancer	DISKIJSX	moderate	Altered Expression	[24]
Thyroid gland papillary carcinoma	DIS48YMM	moderate	Biomarker	[26]
Cerebral infarction	DISR1WNP	Disputed	Biomarker	[27]
Melanoma	DIS1RRCY	Disputed	Altered Expression	[28]
Neuroblastoma	DISVZBI4	Disputed	Biomarker	[27]
Acute leukaemia	DISDQFDI	Limited	Altered Expression	[29]
Breast cancer	DIS7DPX1	Limited	Biomarker	[30]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[30]
Cardiomyopathy	DISUPZRG	Limited	Genetic Variation	[9]
Epithelial ovarian cancer	DIS56MH2	Limited	Biomarker	[31]
Ovarian cancer	DISZJHAP	Limited	Biomarker	[31]
Ovarian neoplasm	DISEAFTY	Limited	Biomarker	[31]
Plasma cell myeloma	DIS0DFZ0	Limited	Genetic Variation	[32]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Daunorubicin	DMQUSBT	Approved	RelA-associated inhibitor (PPP1R13L) decreases the response to substance of Daunorubicin.	[16]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of RelA-associated inhibitor (PPP1R13L).	[33]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of RelA-associated inhibitor (PPP1R13L).	[40]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of RelA-associated inhibitor (PPP1R13L).	[47]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of RelA-associated inhibitor (PPP1R13L).	[50]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of RelA-associated inhibitor (PPP1R13L).	[51]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of RelA-associated inhibitor (PPP1R13L).	[50]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of RelA-associated inhibitor (PPP1R13L).	[34]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of RelA-associated inhibitor (PPP1R13L).	[35]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of RelA-associated inhibitor (PPP1R13L).	[36]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of RelA-associated inhibitor (PPP1R13L).	[37]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of RelA-associated inhibitor (PPP1R13L).	[38]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of RelA-associated inhibitor (PPP1R13L).	[39]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of RelA-associated inhibitor (PPP1R13L).	[41]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of RelA-associated inhibitor (PPP1R13L).	[42]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of RelA-associated inhibitor (PPP1R13L).	[43]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of RelA-associated inhibitor (PPP1R13L).	[44]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of RelA-associated inhibitor (PPP1R13L).	[45]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of RelA-associated inhibitor (PPP1R13L).	[46]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of RelA-associated inhibitor (PPP1R13L).	[48]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of RelA-associated inhibitor (PPP1R13L).	[49]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of RelA-associated inhibitor (PPP1R13L).	[52]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of RelA-associated inhibitor (PPP1R13L).	[53]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of RelA-associated inhibitor (PPP1R13L).	[54]

References

• [1] LONG-TERM OUTCOMES AND PROGNOSTIC FACTORS IN PATIENTS WITH DIFFERENTIATED THYROID CARCINOMA AND BONE METASTASES.Endocr Pract. 2019 May;25(5):427-437. doi: 10.4158/EP-2018-0465. Epub 2019 Jan 18.
• [2] Methylation status of the PPP1R13L promoter region among lung cancer patients and healthy controls. Analytical cross-sectional study.Sao Paulo Med J. 2019 Aug 29;137(3):255-261. doi: 10.1590/1516-3180.2018.0358230419.
• [3] Predictors and Clinical Outcomes of Treatment Intensification in Patients With Type 2 Diabetes Uncontrolled on Basal Insulin in a Real-World Setting.Endocr Pract. 2018 Sep;24(9):805-814. doi: 10.4158/EP-2017-0261. Epub 2018 Jul 5.
• [4] Comparison Between Automatic and Visual Scorings of REM Sleep Without Atonia for the Diagnosis of REM Sleep Behavior Disorder in Parkinson Disease.Sleep. 2017 Feb 1;40(2). doi: 10.1093/sleep/zsw060.
• [5] MicroRNA124 regulate cell growth of prostate cancer cells by targeting iASPP.Int J Clin Exp Pathol. 2014 Apr 15;7(5):2283-90. eCollection 2014.
• [6] Focused screening of a panel of cancer-related genetic polymorphisms reveals new susceptibility loci for pediatric acute lymphoblastic leukemia.Pediatr Blood Cancer. 2014 Aug;61(8):1411-5. doi: 10.1002/pbc.25011. Epub 2014 Mar 6.
• [7] Enhanced expressions of FHL2 and iASPP predict poor prognosis in acute myeloid leukemia.Cancer Gene Ther. 2019 Feb;26(1-2):17-25. doi: 10.1038/s41417-018-0027-0. Epub 2018 Jun 18.
• [8] Effects of polymorphisms in ERCC1, ASE-1 and RAI on the risk of colorectal carcinomas and adenomas: a case control study.BMC Cancer. 2006 Jul 3;6:175. doi: 10.1186/1471-2407-6-175.
• [9] iASPP, a previously unidentified regulator of desmosomes, prevents arrhythmogenic right ventricular cardiomyopathy (ARVC)-induced sudden death.Proc Natl Acad Sci U S A. 2015 Mar 3;112(9):E973-81. doi: 10.1073/pnas.1408111112. Epub 2015 Feb 17.
• [10] iASPP, a microRNA?24 target, is aberrantly expressed in astrocytoma and regulatesmalignantgliomacellmigration and viability.Mol Med Rep. 2018 Jan;17(1):1970-1978. doi: 10.3892/mmr.2017.8097. Epub 2017 Nov 15.
• [11] iASPP induces EMT and cisplatin resistance in human cervical cancer through miR-20a-FBXL5/BTG3 signaling.J Exp Clin Cancer Res. 2017 Apr 11;36(1):48. doi: 10.1186/s13046-017-0520-6.
• [12] Wild-type and mutant p53 differentially modulate miR-124/iASPP feedback following pohotodynamic therapy in human colon cancer cell line.Cell Death Dis. 2017 Oct 12;8(10):e3096. doi: 10.1038/cddis.2017.477.
• [13] Sequence variation in PPP1R13L results in a novel form of cardio-cutaneous syndrome.EMBO Mol Med. 2017 Mar;9(3):319-336. doi: 10.15252/emmm.201606523.
• [14] Increased expression of iASPP, regulated by hepatitis B virus X protein-mediated NF-B activation, in hepatocellular carcinoma.Gastroenterology. 2010 Dec;139(6):2183-2194.e5. doi: 10.1053/j.gastro.2010.06.049. Epub 2010 Jun 20.
• [15] Down-regulation of iASPP in human hepatocellular carcinoma cells inhibits cell proliferation and tumor growth.Neoplasma. 2011;58(3):205-10. doi: 10.4149/neo_2011_03_205.
• [16] siRNA-mediated down-regulation of iASPP promotes apoptosis induced by etoposide and daunorubicin in leukemia cells expressing wild-type p53. Leuk Res. 2009 Sep;33(9):1243-8. doi: 10.1016/j.leukres.2009.02.016. Epub 2009 Mar 18.
• [17] Primary Adrenal Insufficiency During Lenvatinib or Vandetanib and Improvement of Fatigue After Cortisone Acetate Therapy.J Clin Endocrinol Metab. 2019 Mar 1;104(3):779-784. doi: 10.1210/jc.2018-01836.
• [18] Risk Haplotypes Uniquely Associated with Radioiodine-Refractory Thyroid Cancer Patients of High African Ancestry.Thyroid. 2019 Apr;29(4):530-539. doi: 10.1089/thy.2018.0687. Epub 2019 Feb 13.
• [19] Different splicing isoforms of ERCC1 affect the expression of its overlapping genes CD3EAP and PPP1R13L, and indicate a potential application in non-small cell lung cancer treatment.Int J Oncol. 2018 Jun;52(6):2155-2165. doi: 10.3892/ijo.2018.4347. Epub 2018 Mar 29.
• [20] The lncRNA XIST interacts with miR-140/miR-124/iASPP axis to promote pancreatic carcinoma growth.Oncotarget. 2017 Nov 20;8(69):113701-113718. doi: 10.18632/oncotarget.22555. eCollection 2017 Dec 26.
• [21] Cell autonomous role of iASPP deficiency in causing cardiocutaneous disorders.Cell Death Differ. 2018 Jul;25(7):1289-1303. doi: 10.1038/s41418-017-0039-6. Epub 2018 Jan 19.
• [22] CD11c expression in chronic lymphocytic leukemia revisited, related with complications and survival.Int J Lab Hematol. 2017 Oct;39(5):552-556. doi: 10.1111/ijlh.12695. Epub 2017 Jun 12.
• [23] Epigenetic Regulation of iASPP-p63 Feedback Loop in Cutaneous Squamous Cell Carcinoma.J Invest Dermatol. 2019 Aug;139(8):1658-1671.e8. doi: 10.1016/j.jid.2019.01.020. Epub 2019 Jan 30.
• [24] Role of Kruppel-like factor 4 in regulating inhibitor of apoptosis-stimulating protein of p53 in the progression of gastric cancer.Oncol Lett. 2018 May;15(5):6865-6872. doi: 10.3892/ol.2018.8203. Epub 2018 Mar 7.
• [25] Identification of key regulatory genes connected to NF-B family of proteins in visceral adipose tissues using gene expression and weighted protein interaction network.PLoS One. 2019 Apr 23;14(4):e0214337. doi: 10.1371/journal.pone.0214337. eCollection 2019.
• [26] BRAF V600E and Retinoic Acid in Radioiodine-Refractory Papillary Thyroid Cancer.Horm Metab Res. 2019 Jan;51(1):69-75. doi: 10.1055/a-0765-9078. Epub 2018 Nov 5.
• [27] The Shc protein RAI promotes an adaptive cell survival program in hypoxic neuroblastoma cells.J Cell Physiol. 2018 May;233(5):4282-4293. doi: 10.1002/jcp.26247. Epub 2017 Nov 24.
• [28] A pro-apoptotic function of iASPP by stabilizing p300 and CBP through inhibition of BRMS1 E3 ubiquitin ligase activity.Cell Death Dis. 2015 Feb 12;6(2):e1634. doi: 10.1038/cddis.2015.17.
• [29] FHL2 interacts with iASPP and impacts the biological functions of leukemia cells.Oncotarget. 2017 Jun 20;8(25):40885-40895. doi: 10.18632/oncotarget.16617.
• [30] The anti-apoptotic proteins NAF-1 and iASPP interact to drive apoptosis in cancer cells.Chem Sci. 2018 Nov 20;10(3):665-673. doi: 10.1039/c8sc03390k. eCollection 2019 Jan 21.
• [31] iASPP and chemoresistance in ovarian cancers: effects on paclitaxel-mediated mitotic catastrophe.Clin Cancer Res. 2011 Nov 1;17(21):6924-33. doi: 10.1158/1078-0432.CCR-11-0588. Epub 2011 Sep 16.
• [32] The importance of a sub-region on chromosome 19q13.3 for prognosis of multiple myeloma patients after high-dose treatment and stem cell support: a linkage disequilibrium mapping in RAI and CD3EAP.Ann Hematol. 2011 Jun;90(6):675-84. doi: 10.1007/s00277-010-1105-z. Epub 2010 Nov 3.
• [33] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [34] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [35] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [36] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [37] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [38] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [39] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [40] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [41] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [42] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [43] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [44] Expression of the RAI gene is conducive to apoptosis: studies of induction and interference. Exp Cell Res. 2007 Jul 15;313(12):2611-21. doi: 10.1016/j.yexcr.2007.05.006. Epub 2007 May 22.
• [45] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [46] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [47] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [48] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [49] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [50] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [51] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [52] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [53] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [54] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [55] siRNA-mediated down-regulation of iASPP promotes apoptosis induced by etoposide and daunorubicin in leukemia cells expressing wild-type p53. Leuk Res. 2009 Sep;33(9):1243-8. doi: 10.1016/j.leukres.2009.02.016. Epub 2009 Mar 18.