Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOHS07E)

• DOT Name: Pulmonary surfactant-associated protein B (SFTPB)
• Synonyms: SP-B; 18 kDa pulmonary-surfactant protein; 6 kDa protein; Pulmonary surfactant-associated proteolipid SPL(Phe)
• Gene Name: SFTPB
• Related Disease:
  Lung cancer
  Respiratory syncytial virus infection
  Adenocarcinoma
  Advanced cancer
  Asthma
  Bacterial pneumonia
  Cardiac failure
  Chorioamnionitis
  Congestive heart failure
  Craniosynostosis
  Cystic fibrosis
  Early-onset anterior polar cataract
  Hantavirus infection
  Hyperinsulinemia
  Hypophosphatasia
  Immunodeficiency
  Influenza
  Large cell carcinoma
  Lung adenocarcinoma
  Lung neoplasm
  Lung squamous cell carcinoma
  Nasal polyp
  Neoplasm
  Pneumocystis pneumonia
  Pneumonitis
  Pulmonary disease
  Respiratory disease
  Respiratory failure
  Surfactant metabolism dysfunction, pulmonary, 1
  Systemic sclerosis
  Thyroid gland papillary carcinoma
  Adult respiratory distress syndrome
  Bacterial infection
  Bronchopulmonary dysplasia
  Pulmonary emphysema
  Non-small-cell lung cancer
  Pneumonia
  Acute respiratory failure
  Congenital diaphragmatic hernia
  Congenital heart disease
  Lung carcinoma
  Obesity
  Type-1/2 diabetes
• UniProt ID: PSPB_HUMAN
• PDB ID: 1DFW; 1KMR; 1RG3; 1RG4; 1SSZ; 2DWF; 2JOU; 2M0H; 2M1T
• Pfam ID: PF02199 ; PF05184 ; PF03489
• Sequence:
  MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVW
  GHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYF
  PLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPV
  LPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPL
  VAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECH
  LCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTC
  QALGVCGTMSSPLQCIHSPDL
• Function: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
• Reactome Pathway:
  Defective pro-SFTPB causes SMDP1 and RDS (R-HSA-5688031)
  Defective CSF2RB causes SMDP5 (R-HSA-5688849)
  Defective CSF2RA causes SMDP4 (R-HSA-5688890)
  Surfactant metabolism (R-HSA-5683826)

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung cancer	DISCM4YA	Definitive	Biomarker	[1]
Respiratory syncytial virus infection	DIS7FWHY	Definitive	Biomarker	[2]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[3]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[4]
Asthma	DISW9QNS	Strong	Biomarker	[2]
Bacterial pneumonia	DISPW7PH	Strong	Genetic Variation	[5]
Cardiac failure	DISDC067	Strong	Biomarker	[6]
Chorioamnionitis	DISL1D9U	Strong	Altered Expression	[7]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[6]
Craniosynostosis	DIS6J405	Strong	Altered Expression	[8]
Cystic fibrosis	DIS2OK1Q	Strong	Genetic Variation	[9]
Early-onset anterior polar cataract	DISTOPIY	Strong	Altered Expression	[10]
Hantavirus infection	DISZFTMH	Strong	Biomarker	[11]
Hyperinsulinemia	DISIDWT6	Strong	Biomarker	[12]
Hypophosphatasia	DISCQ0O2	Strong	Altered Expression	[13]
Immunodeficiency	DIS093I0	Strong	Altered Expression	[14]
Influenza	DIS3PNU3	Strong	Genetic Variation	[15]
Large cell carcinoma	DISYMCOF	Strong	Altered Expression	[16]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[1]
Lung neoplasm	DISVARNB	Strong	Biomarker	[17]
Lung squamous cell carcinoma	DISXPIBD	Strong	Genetic Variation	[18]
Nasal polyp	DISLP3XE	Strong	Altered Expression	[8]
Neoplasm	DISZKGEW	Strong	Biomarker	[19]
Pneumocystis pneumonia	DISFSOM3	Strong	Altered Expression	[14]
Pneumonitis	DIS88E0K	Strong	Altered Expression	[20]
Pulmonary disease	DIS6060I	Strong	Biomarker	[21]
Respiratory disease	DISGGAGJ	Strong	Biomarker	[22]
Respiratory failure	DISVMYJO	Strong	Biomarker	[23]
Surfactant metabolism dysfunction, pulmonary, 1	DISRYUG0	Strong	Autosomal recessive	[24]
Systemic sclerosis	DISF44L6	Strong	Genetic Variation	[25]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Biomarker	[26]
Adult respiratory distress syndrome	DISIJV47	moderate	Biomarker	[27]
Bacterial infection	DIS5QJ9S	moderate	Biomarker	[28]
Bronchopulmonary dysplasia	DISO0BY5	moderate	Biomarker	[29]
Pulmonary emphysema	DIS5M7HZ	moderate	Altered Expression	[30]
Non-small-cell lung cancer	DIS5Y6R9	Disputed	Genetic Variation	[31]
Pneumonia	DIS8EF3M	Disputed	Genetic Variation	[32]
Acute respiratory failure	DIS5KQ5Y	Limited	Genetic Variation	[33]
Congenital diaphragmatic hernia	DIS0IPVU	Limited	Biomarker	[34]
Congenital heart disease	DISQBA23	Limited	Altered Expression	[35]
Lung carcinoma	DISTR26C	Limited	Biomarker	[1]
Obesity	DIS47Y1K	Limited	Biomarker	[36]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[37]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Pulmonary surfactant-associated protein B (SFTPB).	[38]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Pulmonary surfactant-associated protein B (SFTPB).	[39]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Pulmonary surfactant-associated protein B (SFTPB).	[40]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Pulmonary surfactant-associated protein B (SFTPB).	[38]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Pulmonary surfactant-associated protein B (SFTPB).	[41]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Pulmonary surfactant-associated protein B (SFTPB).	[42]
Permethrin	DMZ0Q1G	Approved	Permethrin affects the expression of Pulmonary surfactant-associated protein B (SFTPB).	[42]
Hydrocortisone	DMGEMB7	Approved	Hydrocortisone increases the expression of Pulmonary surfactant-associated protein B (SFTPB).	[43]
Cholecalciferol	DMGU74E	Approved	Cholecalciferol increases the expression of Pulmonary surfactant-associated protein B (SFTPB).	[38]
Terbutaline	DMD4381	Approved	Terbutaline increases the expression of Pulmonary surfactant-associated protein B (SFTPB).	[43]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Pulmonary surfactant-associated protein B (SFTPB).	[44]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Pulmonary surfactant-associated protein B (SFTPB).	[46]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Pulmonary surfactant-associated protein B (SFTPB).	[47]
Manganese	DMKT129	Investigative	Manganese increases the expression of Pulmonary surfactant-associated protein B (SFTPB).	[48]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Pulmonary surfactant-associated protein B (SFTPB).	[45]

References

• [1] Inhibition of human lung adenocarcinoma growth and metastasis by JC polyomavirus-like particles packaged with an SP-B promoter-driven CD59-specific shRNA.Clin Sci (Lond). 2019 Nov 15;133(21):2159-2169. doi: 10.1042/CS20190395.
• [2] Surfactant protein B polymorphisms are associated with severe respiratory syncytial virus infection, but not with asthma.BMC Pulm Med. 2007 May 11;7:6. doi: 10.1186/1471-2466-7-6.
• [3] A combination of molecular markers accurately detects lymph node metastasis in non-small cell lung cancer patients.Clin Cancer Res. 2006 Apr 15;12(8):2484-91. doi: 10.1158/1078-0432.CCR-05-2037.
• [4] Novel molecular tumor cell markers in regional lymph nodes and blood samples from patients undergoing surgery for non-small cell lung cancer.PLoS One. 2013 May 3;8(5):e62153. doi: 10.1371/journal.pone.0062153. Print 2013.
• [5] DIFFERENTIAL SUSCEPTIBILITY OF HUMAN SP-B GENETIC VARIANTS ON LUNG INJURY CAUSED BY BACTERIAL PNEUMONIA AND THE EFFECT OF A CHEMICALLY MODIFIED CURCUMIN.Shock. 2016 Apr;45(4):375-84. doi: 10.1097/SHK.0000000000000535.
• [6] Immature surfactant protein-B impairs the antioxidant capacity of HDL.Int J Cardiol. 2019 Jun 15;285:53-58. doi: 10.1016/j.ijcard.2019.02.057. Epub 2019 Feb 27.
• [7] Surfactant Components and Tracheal Aspirate Inflammatory Markers in Preterm Infants with Respiratory Distress Syndrome.J Pediatr. 2018 Dec;203:442-446. doi: 10.1016/j.jpeds.2018.08.019. Epub 2018 Sep 27.
• [8] Surfactant protein B detection and gene expression in chronic rhinosinusitis.Laryngoscope. 2007 Jul;117(7):1296-301. doi: 10.1097/MLG.0b013e31805c9a28.
• [9] Genetic Association of Pulmonary Surfactant Protein Genes, SFTPA1, SFTPA2, SFTPB, SFTPC, and SFTPD With Cystic Fibrosis.Front Immunol. 2018 Oct 2;9:2256. doi: 10.3389/fimmu.2018.02256. eCollection 2018.
• [10] Aberrant SP-B mRNA in lung tissue of patients with congenital alveolar proteinosis (CAP).Clin Genet. 2000 May;57(5):359-69. doi: 10.1034/j.1399-0004.2000.570506.x.
• [11] Gene-edited MLE-15 Cells as a Model for the Hermansky-Pudlak Syndromes.Am J Respir Cell Mol Biol. 2018 May;58(5):566-574. doi: 10.1165/rcmb.2017-0324MA.
• [12] The combined effects of insulin and cortisol on surfactant protein mRNA levels.Pediatr Res. 1995 Oct;38(4):513-21. doi: 10.1203/00006450-199510000-00007.
• [13] An alternatively spliced surfactant protein B mRNA in normal human lung: disease implication.Biochem J. 1999 Oct 1;343 Pt 1(Pt 1):145-9.
• [14] Inhibition of lung surfactant protein B expression during Pneumocystis carinii pneumonia in mice.J Lab Clin Med. 1999 May;133(5):423-33. doi: 10.1016/s0022-2143(99)90019-7.
• [15] Surfactant protein B gene polymorphism is associated with severe influenza.Chest. 2014 Jun;145(6):1237-1243. doi: 10.1378/chest.13-1651.
• [16] Gene Therapy for Human Lung Adenocarcinoma Using a Suicide Gene Driven by a Lung-Specific Promoter Delivered by JC Virus-Like Particles.PLoS One. 2016 Jun 20;11(6):e0157865. doi: 10.1371/journal.pone.0157865. eCollection 2016.
• [17] Surfactant protein B gene variations and susceptibility to lung cancer in chromate workers.Am J Ind Med. 2006 May;49(5):367-73. doi: 10.1002/ajim.20283.
• [18] Surfactant protein B gene variations enhance susceptibility to squamous cell carcinoma of the lung in German patients.Br J Cancer. 2002 Jul 15;87(2):212-7. doi: 10.1038/sj.bjc.6600353.
• [19] Tissue-specific, tumor-selective, replication-competent adenovirus vector for cancer gene therapy.J Virol. 2001 Apr;75(7):3314-24. doi: 10.1128/JVI.75.7.3314-3324.2001.
• [20] Up-regulation of SFTPB expression and attenuation of acute lung injury by pulmonary epithelial cell-specific NAMPT knockdown.FASEB J. 2018 Jul;32(7):3583-3596. doi: 10.1096/fj.201701059R. Epub 2018 Feb 8.
• [21] C-proSP-B: A Possible Biomarker for Pulmonary Diseases?.Respiration. 2018;96(2):117-126. doi: 10.1159/000488245. Epub 2018 May 15.
• [22] Genetic disorders of surfactant protein dysfunction: when to consider and how to investigate.Arch Dis Child. 2017 Jan;102(1):84-90. doi: 10.1136/archdischild-2012-303143. Epub 2016 Jul 14.
• [23] Quenching of tryptophan fluorescence in a highly scattering solution: Insights on protein localization in a lung surfactant formulation.PLoS One. 2018 Aug 3;13(8):e0201926. doi: 10.1371/journal.pone.0201926. eCollection 2018.
• [24] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [25] Genetic polymorphisms in the surfactant proteins in systemic sclerosis in Japanese: T/T genotype at 1580 C/T (Thr131Ile) in the SP-B gene reduces the risk of interstitial lung disease.Rheumatology (Oxford). 2008 Mar;47(3):289-91. doi: 10.1093/rheumatology/kem355. Epub 2008 Feb 8.
• [26] Diagnostic usefulness of PCR profiling of the differentially expressed marker genes in thyroid papillary carcinomas.Cancer Lett. 2005 Jun 28;224(2):289-301. doi: 10.1016/j.canlet.2004.10.012. Epub 2004 Nov 18.
• [27] In vitro and in vivo comparison between poractant alfa and the new generation synthetic surfactant CHF5633.Pediatr Res. 2017 Feb;81(2):369-375. doi: 10.1038/pr.2016.231. Epub 2016 Nov 3.
• [28] Differential susceptibility of transgenic mice expressing human surfactant protein B genetic variants to Pseudomonas aeruginosa induced pneumonia.Biochem Biophys Res Commun. 2016 Jan 8;469(2):171-5. doi: 10.1016/j.bbrc.2015.11.089. Epub 2015 Nov 24.
• [29] Surfactant status and respiratory outcome in premature infants receiving late surfactant treatment.Pediatr Res. 2019 Feb;85(3):305-311. doi: 10.1038/s41390-018-0144-3. Epub 2018 Aug 15.
• [30] rHuKGF ameliorates protease/anti-protease imbalance in emphysematous mice.Pulm Pharmacol Ther. 2017 Aug;45:124-135. doi: 10.1016/j.pupt.2017.05.013. Epub 2017 May 25.
• [31] Gene polymorphisms of SFTPB rs7316, rs9752 and PAOX rs1046175 affect the diagnostic value of plasma Pro-SFTPB and DAS in Chinese Han non-small-cell lung cancer patients.J Cell Biochem. 2019 Sep;120(9):14804-14812. doi: 10.1002/jcb.28741. Epub 2019 Apr 23.
• [32] Regulatory Roles of Human Surfactant Protein B Variants on Genetic Susceptibility to Pseudomonas Aeruginosa Pneumonia-Induced Sepsis.Shock. 2020 Oct;54(4):507-519. doi: 10.1097/SHK.0000000000001494.
• [33] Surfactant protein B intron 4 variation in German patients with COPD and acute respiratory failure.Dis Markers. 2002;18(3):129-36. doi: 10.1155/2002/194075.
• [34] Protective effect of baicalin on fetal lung development in a rabbit model of congenital diaphragmatic hernia.Exp Ther Med. 2018 Jan;15(1):61-66. doi: 10.3892/etm.2017.5409. Epub 2017 Oct 31.
• [35] Decreased surfactant proteins in lambs with pulmonary hypertension secondary to increased blood flow.Am J Physiol Lung Cell Mol Physiol. 2001 Nov;281(5):L1264-70. doi: 10.1152/ajplung.2001.281.5.L1264.
• [36] Diminished lung compliance and elevated surfactant lipids and proteins in nutritionally obese young rats.Lung. 2004;182(2):101-17. doi: 10.1007/s00408-003-1048-4.
• [37] The reduction in FOXA2 activity during lung development in fetuses from diabetic rat mothers is reversed by Akt inhibition.FEBS Open Bio. 2018 Sep 25;8(10):1594-1604. doi: 10.1002/2211-5463.12517. eCollection 2018 Oct.
• [38] Glucocorticoid regulation of human pulmonary surfactant protein-B (SP-B) mRNA stability is independent of activated glucocorticoid receptor. Am J Physiol Lung Cell Mol Physiol. 2011 Jun;300(6):L940-50. doi: 10.1152/ajplung.00420.2010. Epub 2011 Mar 11.
• [39] Regulation of human pulmonary surfactant protein gene expression by 1alpha,25-dihydroxyvitamin D3. Am J Physiol Lung Cell Mol Physiol. 2005 Oct;289(4):L617-26. doi: 10.1152/ajplung.00129.2004. Epub 2005 Jun 10.
• [40] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [41] Reduction of glucocorticoid receptor ligand binding by the 11-beta hydroxysteroid dehydrogenase type 2 inhibitor, Thiram. Steroids. 2006 Oct;71(10):895-901.
• [42] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [43] Regulation of messenger RNAs for the hydrophobic surfactant proteins in human lung. J Clin Invest. 1989 Apr;83(4):1191-7. doi: 10.1172/JCI114000.
• [44] Grape resveratrol increases serum adiponectin and downregulates inflammatory genes in peripheral blood mononuclear cells: a triple-blind, placebo-controlled, one-year clinical trial in patients with stable coronary artery disease. Cardiovasc Drugs Ther. 2013 Feb;27(1):37-48. doi: 10.1007/s10557-012-6427-8.
• [45] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [46] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [47] Pneumoproteins as markers of paraquat lung injury: a clinical case. J Forensic Leg Med. 2008 Jan;15(1):48-52. doi: 10.1016/j.jcfm.2006.09.003. Epub 2006 Dec 14.
• [48] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.