Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOL02QN)

• DOT Name: Probable ATP-dependent RNA helicase DHX40 (DHX40)
• Synonyms: EC 3.6.4.13; DEAH box protein 40; Protein PAD
• Gene Name: DHX40
• Related Disease:
  Arteriosclerosis
  Atherosclerosis
  Abdominal aortic aneurysm
  Acute coronary syndrome
  Acute myocardial infarction
  Allergic rhinitis
  Alzheimer disease
  Anemia
  Arterial disorder
  Carotid stenosis
  Chikungunya virus infection
  Dementia
  Dengue
  High blood pressure
  Hyperlipidemia
  Juvenile myoclonic epilepsy
  Kidney failure
  Multiple sclerosis
  Non-insulin dependent diabetes
  Obesity
  Pancreatic cancer
  Peripheral arterial disease
  Peripheral vascular disease
  Plasma cell myeloma
  Rheumatoid arthritis
  Sjogren syndrome
  Stroke
  Systemic lupus erythematosus
  Temporal lobe epilepsy
  Triple negative breast cancer
  Type-1/2 diabetes
  Unverricht-Lundborg syndrome
  Cardiovascular disease
  Periodontal disease
  Periodontitis
  Prediabetes syndrome
  Seasonal affective disorder
  Coronary heart disease
  Neoplasm
  Intermittent claudication
• UniProt ID: DHX40_HUMAN
• EC Number: 3.6.4.13
• Pfam ID: PF00270 ; PF21010 ; PF04408 ; PF00271 ; PF07717
• Sequence:
  MSRFPAVAGRAPRRQEEGERSRDLQEERLSAVCIADREEKGCTSQEGGTTPTFPIQKQRK
  KIIQAVRDNSFLIVTGNTGSGKTTQLPKYLYEAGFSQHGMIGVTQPRKVAAISVAQRVAE
  EMKCTLGSKVGYQVRFDDCSSKETAIKYMTDGCLLKHILGDPNLTKFSVIILDEAHERTL
  TTDILFGLLKKLFQEKSPNRKEHLKVVVMSATMELAKLSAFFGNCPIFDIPGRLYPVREK
  FCNLIGPRDRENTAYIQAIVKVTMDIHLNEMAGDILVFLTGQFEIEKSCELLFQMAESVD
  YDYDVQDTTLDGLLILPCYGSMTTDQQRRIFLPPPPGIRKCVISTNISATSLTIDGIRYV
  VDGGFVKQLNHNPRLGLDILEVVPISKSEALQRSGRAGRTSSGKCFRIYSKDFWNQCMPD
  HVIPEIKRTSLTSVVLTLKCLAIHDVIRFPYLDPPNERLILEALKQLYQCDAIDRSGHVT
  RLGLSMVEFPLPPHLTCAVIKAASLDCEDLLLPIAAMLSVENVFIRPVDPEYQKEAEQRH
  RELAAKAGGFNDFATLAVIFEQCKSSGAPASWCQKHWIHWRCLFSAFRVEAQLRELIRKL
  KQQSDFPKETFEGPKHEVLRRCLCAGYFKNVARRSVGRTFCTMDGRGSPVHIHPSSALHE
  QETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLHEFNAHDLSSVARREVREDAR
  RRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARFLERKQQRTQDHSDTRKETG
• Function: Probable ATP-dependent RNA helicase.
• Tissue Specificity: Ubiquitously expressed.

Molecular Interaction Atlas (MIA) of This DOT

40 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Arteriosclerosis	DISK5QGC	Definitive	Biomarker	[1]
Atherosclerosis	DISMN9J3	Definitive	Biomarker	[1]
Abdominal aortic aneurysm	DISD06OF	Strong	Genetic Variation	[2]
Acute coronary syndrome	DIS7DYEW	Strong	Biomarker	[3]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[4]
Allergic rhinitis	DIS3U9HN	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[6]
Anemia	DISTVL0C	Strong	Biomarker	[7]
Arterial disorder	DISLG4XS	Strong	Biomarker	[8]
Carotid stenosis	DISZA8D0	Strong	Biomarker	[9]
Chikungunya virus infection	DISDXEHY	Strong	Biomarker	[10]
Dementia	DISXL1WY	Strong	Biomarker	[11]
Dengue	DISKH221	Strong	Biomarker	[12]
High blood pressure	DISY2OHH	Strong	Biomarker	[13]
Hyperlipidemia	DIS61J3S	Strong	Biomarker	[14]
Juvenile myoclonic epilepsy	DISYXV1N	Strong	Biomarker	[15]
Kidney failure	DISOVQ9P	Strong	Biomarker	[16]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[17]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[18]
Obesity	DIS47Y1K	Strong	Biomarker	[19]
Pancreatic cancer	DISJC981	Strong	Genetic Variation	[20]
Peripheral arterial disease	DIS78WFB	Strong	Biomarker	[21]
Peripheral vascular disease	DISXSU1Y	Strong	Biomarker	[22]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[23]
Rheumatoid arthritis	DISTSB4J	Strong	Altered Expression	[24]
Sjogren syndrome	DISUBX7H	Strong	Biomarker	[25]
Stroke	DISX6UHX	Strong	Biomarker	[26]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[27]
Temporal lobe epilepsy	DISNOPXX	Strong	Biomarker	[15]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[28]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[29]
Unverricht-Lundborg syndrome	DISG4WLX	Strong	Biomarker	[15]
Cardiovascular disease	DIS2IQDX	moderate	Biomarker	[3]
Periodontal disease	DISJQHVN	moderate	Altered Expression	[30]
Periodontitis	DISI9JOI	moderate	Altered Expression	[30]
Prediabetes syndrome	DISH2I53	moderate	Biomarker	[29]
Seasonal affective disorder	DIS908VO	moderate	Biomarker	[31]
Coronary heart disease	DIS5OIP1	Disputed	Biomarker	[32]
Neoplasm	DISZKGEW	Disputed	Biomarker	[33]
Intermittent claudication	DISGY3B0	Limited	Biomarker	[34]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Probable ATP-dependent RNA helicase DHX40 (DHX40).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Probable ATP-dependent RNA helicase DHX40 (DHX40).	[36]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Probable ATP-dependent RNA helicase DHX40 (DHX40).	[37]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Probable ATP-dependent RNA helicase DHX40 (DHX40).	[38]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Probable ATP-dependent RNA helicase DHX40 (DHX40).	[39]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Probable ATP-dependent RNA helicase DHX40 (DHX40).	[42]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Probable ATP-dependent RNA helicase DHX40 (DHX40).	[40]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Probable ATP-dependent RNA helicase DHX40 (DHX40).	[41]

References

• [1] Risk of obstructive coronary artery disease and major adverse cardiac events in patients with noncoronary atherosclerosis: Insights from the Veterans Affairs Clinical Assessment, Reporting, and Tracking (CART) Program.Am Heart J. 2019 Jul;213:47-56. doi: 10.1016/j.ahj.2019.04.004. Epub 2019 Apr 15.
• [2] ACE and TGFBR1 genes interact in influencing the susceptibility to abdominal aortic aneurysm.Atherosclerosis. 2009 Jan;202(1):205-10. doi: 10.1016/j.atherosclerosis.2008.04.038. Epub 2008 Apr 29.
• [3] Under-prescription of novel antiplatelet drugs in patients with acute coronary syndrome and previous cardiovascular disease.Minerva Med. 2019 Oct;110(5):410-418. doi: 10.23736/S0026-4806.19.05859-2. Epub 2019 May 6.
• [4] Paper microfluidic device for early diagnosis and prognosis of acute myocardial infarction via quantitative multiplex cardiac biomarker detection.Biosens Bioelectron. 2019 Mar 1;128:176-185. doi: 10.1016/j.bios.2018.12.049. Epub 2019 Jan 9.
• [5] The Allergic Rhinitis Clinical Investigator Collaborative (AR-CIC): verification of nasal allergen challenge procedures in a study utilizing an investigational immunotherapy for cat allergy.Clin Transl Allergy. 2018 Apr 12;8:15. doi: 10.1186/s13601-018-0198-7. eCollection 2018.
• [6] Association between Polymorphisms of the AKT1 Gene Promoter and Risk of the Alzheimer's Disease in a Chinese Han Population with Type 2 Diabetes.CNS Neurosci Ther. 2015 Aug;21(8):619-25. doi: 10.1111/cns.12430. Epub 2015 Jul 14.
• [7] Anemia in patients with diabetic foot ulcer and its impact on disease outcome among Nigerians: Results from the MEDFUN study.PLoS One. 2019 Dec 17;14(12):e0226226. doi: 10.1371/journal.pone.0226226. eCollection 2019.
• [8] Drug-coated balloons versus drug-eluting stents in the femoropopliteal artery: comparing apples to oranges?.J Cardiovasc Surg (Torino). 2019 Aug;60(4):456-459. doi: 10.23736/S0021-9509.19.10953-6. Epub 2019 Apr 15.
• [9] Grip strength measurement for frailty assessment in patients with vascular disease and associations with comorbidity, cardiac risk, and sarcopenia.J Vasc Surg. 2018 May;67(5):1512-1520. doi: 10.1016/j.jvs.2017.08.078. Epub 2017 Dec 21.
• [10] Detection of chikungunya virus-specific IgM on laser-cut paper-based device using pseudo-particles as capture antigen.J Med Virol. 2019 Jun;91(6):899-910. doi: 10.1002/jmv.25420. Epub 2019 Feb 8.
• [11] On Legalizing Physician-Assisted Death for Dementia.Hastings Cent Rep. 2017 Jul;47(4):5-6. doi: 10.1002/hast.731.
• [12] Laser-cut paper-based device for the detection of dengue non-structural NS1 protein and specific IgM in human samples.Arch Virol. 2018 Jul;163(7):1757-1767. doi: 10.1007/s00705-018-3776-z. Epub 2018 Mar 10.
• [13] Minimally Invasive Aortobiilliofemoral Endarterectomy for Aortoiliac Occlusive Disease Is a Compelling Alternative to Bypass.Vasc Endovascular Surg. 2019 Feb;53(2):97-103. doi: 10.1177/1538574418807104. Epub 2018 Nov 14.
• [14] Epidemiology of risk factors of atherosclerosis and preventive program for youth.Int Angiol. 1990 Jan-Mar;9(1):20-1.
• [15] Neuroimaging-based brain-age prediction in diverse forms of epilepsy: a signature of psychosis and beyond.Mol Psychiatry. 2021 Mar;26(3):825-834. doi: 10.1038/s41380-019-0446-9. Epub 2019 Jun 3.
• [16] The relationship of renal function to segmental vascular stiffness, ankle-brachial index, and peripheral artery disease.J Clin Hypertens (Greenwich). 2018 Jun;20(6):1027-1035. doi: 10.1111/jch.13297. Epub 2018 May 11.
• [17] Inhibitors of protein arginine deiminases and their efficacy in animal models of multiple sclerosis.Bioorg Med Chem. 2017 May 1;25(9):2643-2656. doi: 10.1016/j.bmc.2017.03.006. Epub 2017 Mar 6.
• [18] Non-invasive vascular assessment in people with type 2 diabetes: Diagnostic performance of Plethysmographic-and-Doppler derived ankle brachial index, toe brachial index, and pulse volume wave analysis for detection of peripheral arterial disease.Prim Care Diabetes. 2020 Jun;14(3):282-289. doi: 10.1016/j.pcd.2019.09.005. Epub 2019 Oct 14.
• [19] Epidemiological investigation into the prevalence of abnormal inter-arm blood pressure differences among different ethnicities in Xinjiang, China.PLoS One. 2018 Jan 18;13(1):e0188546. doi: 10.1371/journal.pone.0188546. eCollection 2018.
• [20] Oral bacteria in pancreatic cancer: mutagenesis of the p53 tumour suppressor gene.Int J Clin Exp Pathol. 2015 Sep 1;8(9):11835-6. eCollection 2015.
• [21] Variability of revascularization techniques among Catalan hospitals and impact on leg salvage in patients with peripheral arterial disease.Int Angiol. 2019 Feb;38(1):54-61. doi: 10.23736/S0392-9590.18.04041-5.
• [22] Ethnic minorities with critical limb ischemia derive equal amputation risk reduction from autologous cell therapy compared with whites.J Vasc Surg. 2018 Aug;68(2):560-566. doi: 10.1016/j.jvs.2017.11.088. Epub 2018 Mar 1.
• [23] The clinical characteristics and prognosis of IGH deletion in multiple myeloma.Leuk Res. 2015 May;39(5):515-9. doi: 10.1016/j.leukres.2015.02.010. Epub 2015 Mar 18.
• [24] Extracellular traps and PAD4 released by macrophages induce citrullination and auto-antibody production in autoimmune arthritis.J Autoimmun. 2019 Dec;105:102297. doi: 10.1016/j.jaut.2019.06.008. Epub 2019 Jul 2.
• [25] Activation of Peptidylarginine Deiminase in the Salivary Glands of Balb/c Mice Drives the Citrullination of Ro and La Ribonucleoproteins.J Immunol Res. 2017;2017:8959687. doi: 10.1155/2017/8959687. Epub 2017 Nov 26.
• [26] Efficacy and safety of more potent antiplatelet therapy with vorapaxar in patients with impaired renal function.J Thromb Thrombolysis. 2019 Apr;47(3):353-360. doi: 10.1007/s11239-018-1779-y.
• [27] Arterial stiffness and peripheral arterial disease in patients with systemic lupus erythematosus.Rheumatol Int. 2017 Feb;37(2):293-298. doi: 10.1007/s00296-016-3610-4. Epub 2016 Nov 21.
• [28] ATF4 Gene Network Mediates Cellular Response to the Anticancer PAD Inhibitor YW3-56 in Triple-Negative Breast Cancer Cells.Mol Cancer Ther. 2015 Apr;14(4):877-88. doi: 10.1158/1535-7163.MCT-14-1093-T. Epub 2015 Jan 22.
• [29] Thrombospondin-4 increases with the severity of peripheral arterial disease and is associated with diabetes.Heart Vessels. 2020 Jan;35(1):52-58. doi: 10.1007/s00380-019-01453-7. Epub 2019 Jun 21.
• [30] The peptidylarginine deiminase gene is a conserved feature of Porphyromonas gingivalis.Sci Rep. 2015 Sep 25;5:13936. doi: 10.1038/srep13936.
• [31] Differential immunomodulation of T-cells by immunoglobulin replacement therapy in primary and secondary antibody deficiency.PLoS One. 2019 Oct 15;14(10):e0223861. doi: 10.1371/journal.pone.0223861. eCollection 2019.
• [32] Pharmacological profile of adenosine A(2A) receptors in patients with lower extremity peripheral artery disease and associated coronary artery disease: A pilot study.Int J Cardiol. 2019 Jun 15;285:121-127. doi: 10.1016/j.ijcard.2019.02.055. Epub 2019 Feb 27.
• [33] The Predictive Value of SPECT/CT imaging in colorectal liver metastases response after 90Y-radioembolization.PLoS One. 2018 Jul 10;13(7):e0200488. doi: 10.1371/journal.pone.0200488. eCollection 2018.
• [34] Underutilization of Evidence-Based Smoking Cessation Support Strategies Despite High Smoking Addiction Burden in Peripheral Artery Disease Specialty Care: Insights from the International PORTRAIT Registry.J Am Heart Assoc. 2018 Oct 16;7(20):e010076. doi: 10.1161/JAHA.118.010076.
• [35] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [36] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [37] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [38] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [39] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [40] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [41] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [42] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.