Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTONO8E6)

DOT Name Transmembrane emp24 domain-containing protein 7 (TMED7)
Synonyms p24 family protein gamma-3; p24gamma3; p27
Gene Name TMED7
Related Disease
Multiple endocrine neoplasia type 1 ( )
Adenoma ( )
B-cell neoplasm ( )
Bladder cancer ( )
Bone osteosarcoma ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Cholangiocarcinoma ( )
Cholestasis ( )
Classic Hodgkin lymphoma ( )
Clear cell renal carcinoma ( )
Colon cancer ( )
Endometrial carcinoma ( )
Epithelial ovarian cancer ( )
Glioma ( )
Hepatocellular carcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Mantle cell lymphoma ( )
Metastatic malignant neoplasm ( )
Neuroblastoma ( )
Non-small-cell lung cancer ( )
Osteosarcoma ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Plasma cell myeloma ( )
Pulmonary fibrosis ( )
Renal cell carcinoma ( )
Small lymphocytic lymphoma ( )
Thyroid tumor ( )
Triple negative breast cancer ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Acute myelogenous leukaemia ( )
Glioblastoma multiforme ( )
Liver cirrhosis ( )
Esophageal squamous cell carcinoma ( )
Melanoma ( )
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Adult glioblastoma ( )
Carcinoma ( )
Colon carcinoma ( )
leukaemia ( )
Leukemia ( )
Liver cancer ( )
Nasopharyngeal carcinoma ( )
Retinopathy ( )
UniProt ID
TMED7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01105
Sequence
MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCT
LEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHK
TVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAE
DLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDKRTTTTRVGS
Function
Potential role in vesicular protein trafficking, mainly in the early secretory pathway. Appears to play a role in the biosynthesis of secreted cargo including processing and post-translational modifications.
Reactome Pathway
COPI-dependent Golgi-to-ER retrograde traffic (R-HSA-6811434 )
COPI-mediated anterograde transport (R-HSA-6807878 )

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Multiple endocrine neoplasia type 1 DIS0RJRK Definitive Genetic Variation [1]
Adenoma DIS78ZEV Strong Biomarker [2]
B-cell neoplasm DISVY326 Strong Altered Expression [3]
Bladder cancer DISUHNM0 Strong Altered Expression [4]
Bone osteosarcoma DIST1004 Strong Posttranslational Modification [5]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Strong Altered Expression [6]
Cholangiocarcinoma DIS71F6X Strong Biomarker [7]
Cholestasis DISDJJWE Strong Biomarker [8]
Classic Hodgkin lymphoma DISV1LU6 Strong Altered Expression [9]
Clear cell renal carcinoma DISBXRFJ Strong Altered Expression [10]
Colon cancer DISVC52G Strong Biomarker [11]
Endometrial carcinoma DISXR5CY Strong Biomarker [12]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [13]
Glioma DIS5RPEH Strong Biomarker [14]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [15]
Lung cancer DISCM4YA Strong Altered Expression [16]
Lung carcinoma DISTR26C Strong Altered Expression [16]
Mantle cell lymphoma DISFREOV Strong Biomarker [17]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [18]
Neuroblastoma DISVZBI4 Strong Altered Expression [19]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [20]
Osteosarcoma DISLQ7E2 Strong Posttranslational Modification [5]
Ovarian cancer DISZJHAP Strong Biomarker [13]
Ovarian neoplasm DISEAFTY Strong Biomarker [13]
Plasma cell myeloma DIS0DFZ0 Strong Posttranslational Modification [21]
Pulmonary fibrosis DISQKVLA Strong Biomarker [22]
Renal cell carcinoma DISQZ2X8 Strong Altered Expression [10]
Small lymphocytic lymphoma DIS30POX Strong Altered Expression [23]
Thyroid tumor DISLVKMD Strong Biomarker [24]
Triple negative breast cancer DISAMG6N Strong Altered Expression [25]
Urinary bladder cancer DISDV4T7 Strong Altered Expression [4]
Urinary bladder neoplasm DIS7HACE Strong Altered Expression [4]
Acute myelogenous leukaemia DISCSPTN moderate Altered Expression [26]
Glioblastoma multiforme DISK8246 moderate Biomarker [27]
Liver cirrhosis DIS4G1GX moderate Biomarker [28]
Esophageal squamous cell carcinoma DIS5N2GV Disputed Altered Expression [29]
Melanoma DIS1RRCY Disputed Biomarker [30]
Thyroid cancer DIS3VLDH Disputed Biomarker [24]
Thyroid gland carcinoma DISMNGZ0 Disputed Biomarker [24]
Adult glioblastoma DISVP4LU Limited Biomarker [27]
Carcinoma DISH9F1N Limited Biomarker [31]
Colon carcinoma DISJYKUO Limited Biomarker [11]
leukaemia DISS7D1V Limited Biomarker [32]
Leukemia DISNAKFL Limited Biomarker [32]
Liver cancer DISDE4BI Limited Altered Expression [6]
Nasopharyngeal carcinoma DISAOTQ0 Limited Altered Expression [33]
Retinopathy DISB4B0F Limited Autosomal recessive [34]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Transmembrane emp24 domain-containing protein 7 (TMED7). [35]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Transmembrane emp24 domain-containing protein 7 (TMED7). [36]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Transmembrane emp24 domain-containing protein 7 (TMED7). [37]
Piroxicam DMTK234 Approved Piroxicam increases the expression of Transmembrane emp24 domain-containing protein 7 (TMED7). [38]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Transmembrane emp24 domain-containing protein 7 (TMED7). [39]
------------------------------------------------------------------------------------

References

1 Hyperparathyroid genes: sequences reveal answers and questions.Endocr Pract. 2011 Jul-Aug;17 Suppl 3(Suppl 3):18-27. doi: 10.4158/EP11067.RA.
2 Expression of Cyclin E/Cdk2/p27(Kip1) in Growth Hormone Adenomas.World Neurosurg. 2019 Jan;121:e45-e53. doi: 10.1016/j.wneu.2018.08.209. Epub 2018 Sep 6.
3 Lost expression of cell adhesion molecule 1 is associated with bladder cancer progression and recurrence and its overexpression inhibited tumor cell malignant behaviors.Oncol Lett. 2019 Feb;17(2):2047-2056. doi: 10.3892/ol.2018.9845. Epub 2018 Dec 18.
4 Transcriptional and post-transcriptional upregulation of p27 mediates growth inhibition of isorhapontigenin (ISO) on human bladder cancer cells.Carcinogenesis. 2018 Mar 8;39(3):482-492. doi: 10.1093/carcin/bgy015.
5 p27/Kip1 functions as a tumor suppressor and oncoprotein in osteosarcoma.Sci Rep. 2019 Apr 16;9(1):6161. doi: 10.1038/s41598-019-42450-0.
6 High GSTP1 inhibits cell proliferation by reducing Akt phosphorylation and is associated with a better prognosis in hepatocellular carcinoma.Oncotarget. 2017 Dec 19;9(10):8957-8971. doi: 10.18632/oncotarget.23420. eCollection 2018 Feb 6.
7 Phosphorylation of P27 by AKT is required for inhibition of cell cycle progression in cholangiocarcinoma.Dig Liver Dis. 2018 May;50(5):501-506. doi: 10.1016/j.dld.2017.12.021. Epub 2018 Jan 4.
8 Classification of Cholestatic and Necrotic Hepatotoxicants Using Transcriptomics on Human Precision-Cut Liver Slices.Chem Res Toxicol. 2016 Mar 21;29(3):342-51. doi: 10.1021/acs.chemrestox.5b00491. Epub 2016 Mar 9.
9 Expression of Foxo3a in non-Hodgkin's lymphomas is correlated with cell cycle inhibitor p27.Eur J Haematol. 2008 Aug;81(2):83-93. doi: 10.1111/j.1600-0609.2008.01077.x. Epub 2008 Mar 19.
10 The long noncoding RNA KCNQ1DN suppresses the survival of renal cell carcinoma cells through downregulating c-Myc.J Cancer. 2019 Aug 19;10(19):4662-4670. doi: 10.7150/jca.29280. eCollection 2019.
11 Construction and characterization of regulated cycle inhibiting factors induced upon Tet-On system in human colon cancer cell lines.Anticancer Drugs. 2018 Oct;29(9):854-860. doi: 10.1097/CAD.0000000000000654.
12 Loss of p27 Associated with Risk for Endometrial Carcinoma Arising in the Setting of Obesity.Curr Mol Med. 2016;16(3):252-65. doi: 10.2174/1566524016666160225153307.
13 Cell Cycle Regulator p27 Mediates Body Mass Index Effects in Ovarian Cancer in FIGO-stages I-II.Cancer Genomics Proteomics. 2019 Nov-Dec;16(6):443-450. doi: 10.21873/cgp.20148.
14 TRIM44 is indispensable for glioma cell proliferation and cell cycle progression through AKT/p21/p27 signaling pathway.J Neurooncol. 2019 Nov;145(2):211-222. doi: 10.1007/s11060-019-03301-0. Epub 2019 Oct 11.
15 Gold nanoparticles-loaded anti-miR221 enhances antitumor effect of sorafenib in hepatocellular carcinoma cells.Int J Med Sci. 2019 Oct 21;16(12):1541-1548. doi: 10.7150/ijms.37427. eCollection 2019.
16 Overexpression of TRPV3 Correlates with Tumor Progression in Non-Small Cell Lung Cancer.Int J Mol Sci. 2016 Mar 24;17(4):437. doi: 10.3390/ijms17040437.
17 Molecular signatures for CCN1, p21 and p27 in progressive mantle cell lymphoma.J Cell Commun Signal. 2019 Sep;13(3):421-434. doi: 10.1007/s12079-018-0494-y. Epub 2018 Nov 21.
18 Cytoplasmic p27 promotes epithelial-mesenchymal transition and tumor metastasis via STAT3-mediated Twist1 upregulation.Oncogene. 2015 Oct;34(43):5447-59. doi: 10.1038/onc.2014.473. Epub 2015 Feb 16.
19 TIPE? suppresses growth and aggressiveness of hepatocellular carcinoma cells through downregulation of the phosphoinositide 3kinase/AKT signaling pathway.Mol Med Rep. 2018 May;17(5):7017-7026. doi: 10.3892/mmr.2018.8789. Epub 2018 Mar 20.
20 Cytoplasmic p27(Kip1) promotes tumorigenesis via suppression of RhoB activity.J Pathol. 2019 Jan;247(1):60-71. doi: 10.1002/path.5167. Epub 2018 Dec 11.
21 ADP-ribosylation factor 1 (ARF1) takes part in cell proliferation and cell adhesion-mediated drug resistance (CAM-DR).Ann Hematol. 2017 May;96(5):847-858. doi: 10.1007/s00277-017-2949-2. Epub 2017 Feb 25.
22 P27 Promotes TGF--Mediated Pulmonary Fibrosis via Interacting with MTORC2.Can Respir J. 2019 Sep 19;2019:7157861. doi: 10.1155/2019/7157861. eCollection 2019.
23 High p27 protein levels in chronic lymphocytic leukemia are associated to low Myc and Skp2 expression, confer resistance to apoptosis and antagonize Myc effects on cell cycle.Oncotarget. 2014 Jul 15;5(13):4694-708. doi: 10.18632/oncotarget.2100.
24 Rewiring of the apoptotic TGF--SMAD/NFB pathway through an oncogenic function of p27 in human papillary thyroid cancer.Oncogene. 2017 Feb 2;36(5):652-666. doi: 10.1038/onc.2016.233. Epub 2016 Jul 25.
25 Role of mitochondria in rescuing glycolytically inhibited subpopulation of triple negative but not hormone-responsive breast cancer cells.Sci Rep. 2019 Sep 24;9(1):13748. doi: 10.1038/s41598-019-50141-z.
26 c-Myc represses FOXO3a-mediated transcription of the gene encoding the p27(Kip1) cyclin dependent kinase inhibitor.J Cell Biochem. 2008 Aug 15;104(6):2091-106. doi: 10.1002/jcb.21765.
27 PKM2 uses control of HuR localization to regulate p27 and cell cycle progression in human glioblastoma cells.Int J Cancer. 2016 Jul 1;139(1):99-111. doi: 10.1002/ijc.30041. Epub 2016 Mar 2.
28 miR-181b promotes hepatic stellate cells proliferation by targeting p27 and is elevated in the serum of cirrhosis patients.Biochem Biophys Res Commun. 2012 Apr 27;421(1):4-8. doi: 10.1016/j.bbrc.2012.03.025. Epub 2012 Mar 13.
29 Targeted therapy of the AKT kinase inhibits esophageal squamous cell carcinoma growth in vitro and in vivo.Int J Cancer. 2019 Aug 15;145(4):1007-1019. doi: 10.1002/ijc.32285. Epub 2019 Apr 3.
30 Loss of tumor suppressors KAI1 and p27 identifies a unique subgroup of primary melanoma patients with poor prognosis.Oncotarget. 2015 Sep 8;6(26):23026-35. doi: 10.18632/oncotarget.4854.
31 Predictive value of FHIT, p27, and pERK1/ERK2 in salivary gland carcinomas: a retrospective study.Clin Oral Investig. 2019 Oct;23(10):3801-3809. doi: 10.1007/s00784-019-02809-z. Epub 2019 Jan 23.
32 CD244 maintains the proliferation ability of leukemia initiating cells through SHP-2/p27(kip1) signaling.Haematologica. 2017 Apr;102(4):707-718. doi: 10.3324/haematol.2016.151555. Epub 2017 Jan 25.
33 Cyclin-Dependent Kinase Inhibitor 3 Promotes Cancer Cell Proliferation and Tumorigenesis in Nasopharyngeal Carcinoma by Targeting p27.Oncol Res. 2017 Nov 2;25(9):1431-1440. doi: 10.3727/096504017X14835311718295. Epub 2017 Jan 20.
34 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
35 Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
36 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
37 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
38 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
39 Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.