Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPSGILV)

• DOT Name: Interleukin-1 alpha (IL1A)
• Synonyms: IL-1 alpha; Hematopoietin-1
• Gene Name: IL1A
• UniProt ID: IL1A_HUMAN
• PDB ID: 2ILA; 2KKI; 2L5X; 5UC6
• Pfam ID: PF00340 ; PF02394
• Sequence:
  MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
  KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS
  NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI
  TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP
  NLFIATKQDYWVCLAGGPPSITDFQILENQA
• Function: Cytokine constitutively present intracellularly in nearly all resting non-hematopoietic cells that plays an important role in inflammation and bridges the innate and adaptive immune systems. After binding to its receptor IL1R1 together with its accessory protein IL1RAP, forms the high affinity interleukin-1 receptor complex. Signaling involves the recruitment of adapter molecules such as MYD88, IRAK1 or IRAK4. In turn, mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways. Within the cell, acts as an alarmin and cell death results in its liberation in the extracellular space after disruption of the cell membrane to induce inflammation and alert the host to injury or damage. In addition to its role as a danger signal, which occurs when the cytokine is passively released by cell necrosis, directly senses DNA damage and acts as a signal for genotoxic stress without loss of cell integrity.
• KEGG Pathway:
  MAPK sig.ling pathway (hsa04010)
  Cytokine-cytokine receptor interaction (hsa04060)
  Necroptosis (hsa04217)
  Cellular senescence (hsa04218)
  Osteoclast differentiation (hsa04380)
  Hematopoietic cell lineage (hsa04640)
  Non-alcoholic fatty liver disease (hsa04932)
  AGE-RAGE sig.ling pathway in diabetic complications (hsa04933)
  Type I diabetes mellitus (hsa04940)
  Alzheimer disease (hsa05010)
  Prion disease (hsa05020)
  Pathways of neurodegeneration - multiple diseases (hsa05022)
  Pertussis (hsa05133)
  Leishmaniasis (hsa05140)
  Tuberculosis (hsa05152)
  Measles (hsa05162)
  Influenza A (hsa05164)
  Inflammatory bowel disease (hsa05321)
  Rheumatoid arthritis (hsa05323)
  Graft-versus-host disease (hsa05332)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway:
  Interleukin-1 processing (R-HSA-448706)
  Pyroptosis (R-HSA-5620971)
  Interleukin-10 signaling (R-HSA-6783783)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  Interleukin-1 signaling (R-HSA-9020702)
  Purinergic signaling in leishmaniasis infection (R-HSA-9660826)
  Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 5 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Amphotericin B	DMTAJQE	Approved	Interleukin-1 alpha (IL1A) increases the Neurotoxicity ADR of Amphotericin B.	[52]
Cyclophosphamide	DM4O2Z7	Approved	Interleukin-1 alpha (IL1A) affects the response to substance of Cyclophosphamide.	[53]
Pentoxifylline	DMU3DNC	Approved	Interleukin-1 alpha (IL1A) increases the Inflammation ADR of Pentoxifylline.	[52]
Losartan	DM72JXH	Approved	Interleukin-1 alpha (IL1A) increases the Capillary fragility increased ADR of Losartan.	[52]
Reteplase	DML0D1P	Approved	Interleukin-1 alpha (IL1A) increases the Tumour necrosis ADR of Reteplase.	[52]

This DOT Affected the Regulation of Drug Effects of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Dinoprostone	DMTYOPD	Approved	Interleukin-1 alpha (IL1A) increases the abundance of Dinoprostone.	[54]
Epoprostenol	DMUTYR2	Approved	Interleukin-1 alpha (IL1A) increases the abundance of Epoprostenol.	[55]
PGF2alpha	DM4XAU7	Clinical trial	Interleukin-1 alpha (IL1A) increases the abundance of PGF2alpha.	[55]

95 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Interleukin-1 alpha (IL1A).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Interleukin-1 alpha (IL1A).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Interleukin-1 alpha (IL1A).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Interleukin-1 alpha (IL1A).	[4]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Interleukin-1 alpha (IL1A).	[5]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Interleukin-1 alpha (IL1A).	[6]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Interleukin-1 alpha (IL1A).	[7]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Interleukin-1 alpha (IL1A).	[8]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Interleukin-1 alpha (IL1A).	[9]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Interleukin-1 alpha (IL1A).	[10]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Interleukin-1 alpha (IL1A).	[11]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Interleukin-1 alpha (IL1A).	[12]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Interleukin-1 alpha (IL1A).	[13]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Interleukin-1 alpha (IL1A).	[14]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Interleukin-1 alpha (IL1A).	[15]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Interleukin-1 alpha (IL1A).	[1]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of Interleukin-1 alpha (IL1A).	[1]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Interleukin-1 alpha (IL1A).	[16]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Interleukin-1 alpha (IL1A).	[17]
Mitomycin	DMH0ZJE	Approved	Mitomycin increases the expression of Interleukin-1 alpha (IL1A).	[18]
Permethrin	DMZ0Q1G	Approved	Permethrin decreases the expression of Interleukin-1 alpha (IL1A).	[17]
Gemcitabine	DMSE3I7	Approved	Gemcitabine decreases the expression of Interleukin-1 alpha (IL1A).	[19]
Zidovudine	DM4KI7O	Approved	Zidovudine increases the expression of Interleukin-1 alpha (IL1A).	[20]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of Interleukin-1 alpha (IL1A).	[21]
Benzatropine	DMF7EXL	Approved	Benzatropine decreases the expression of Interleukin-1 alpha (IL1A).	[1]
Pioglitazone	DMKJ485	Approved	Pioglitazone increases the expression of Interleukin-1 alpha (IL1A).	[1]
Liothyronine	DM6IR3P	Approved	Liothyronine increases the expression of Interleukin-1 alpha (IL1A).	[1]
Hydrocortisone	DMGEMB7	Approved	Hydrocortisone decreases the expression of Interleukin-1 alpha (IL1A).	[22]
Rofecoxib	DM3P5DA	Approved	Rofecoxib decreases the expression of Interleukin-1 alpha (IL1A).	[1]
Nefazodone	DM4ZS8M	Approved	Nefazodone decreases the expression of Interleukin-1 alpha (IL1A).	[1]
Isoproterenol	DMK7MEY	Approved	Isoproterenol decreases the expression of Interleukin-1 alpha (IL1A).	[23]
Isoniazid	DM5JVS3	Approved	Isoniazid increases the expression of Interleukin-1 alpha (IL1A).	[1]
Mebendazole	DMO14SG	Approved	Mebendazole increases the expression of Interleukin-1 alpha (IL1A).	[1]
Estriol	DMOEM2I	Approved	Estriol decreases the expression of Interleukin-1 alpha (IL1A).	[4]
Clavulanate	DM2FGRT	Approved	Clavulanate increases the expression of Interleukin-1 alpha (IL1A).	[1]
Benzoic acid	DMKB9FI	Approved	Benzoic acid increases the expression of Interleukin-1 alpha (IL1A).	[24]
Sodium chloride	DMM3950	Approved	Sodium chloride increases the expression of Interleukin-1 alpha (IL1A).	[16]
Amodiaquine	DME4RA8	Approved	Amodiaquine decreases the expression of Interleukin-1 alpha (IL1A).	[1]
Etodolac	DM6WJO9	Approved	Etodolac increases the expression of Interleukin-1 alpha (IL1A).	[1]
Salbutamol	DMN9CWF	Approved	Salbutamol decreases the expression of Interleukin-1 alpha (IL1A).	[1]
Fexofenadine	DM17ONX	Approved	Fexofenadine decreases the expression of Interleukin-1 alpha (IL1A).	[1]
Entacapone	DMLBVKQ	Approved	Entacapone increases the expression of Interleukin-1 alpha (IL1A).	[1]
Trazodone	DMK1GBJ	Approved	Trazodone increases the expression of Interleukin-1 alpha (IL1A).	[1]
Primaquine	DMWQ16I	Approved	Primaquine decreases the expression of Interleukin-1 alpha (IL1A).	[1]
Promethazine	DM6I5GR	Approved	Promethazine increases the expression of Interleukin-1 alpha (IL1A).	[1]
Bromfenac	DMKB79O	Approved	Bromfenac increases the expression of Interleukin-1 alpha (IL1A).	[1]
Metoprolol	DMOJ0V6	Approved	Metoprolol increases the expression of Interleukin-1 alpha (IL1A).	[26]
Ethambutol	DMR87LC	Approved	Ethambutol increases the expression of Interleukin-1 alpha (IL1A).	[1]
Fludrocortisone	DMUDIR8	Approved	Fludrocortisone decreases the expression of Interleukin-1 alpha (IL1A).	[1]
Amikacin	DM5PDRB	Approved	Amikacin decreases the expression of Interleukin-1 alpha (IL1A).	[1]
Trihexyphenidyl	DMB19L8	Approved	Trihexyphenidyl increases the expression of Interleukin-1 alpha (IL1A).	[1]
Procyclidine	DMHFJDT	Approved	Procyclidine increases the expression of Interleukin-1 alpha (IL1A).	[1]
Penbutolol	DM4ES8F	Approved	Penbutolol increases the expression of Interleukin-1 alpha (IL1A).	[1]
Aciclovir	DMYLOVR	Approved	Aciclovir increases the expression of Interleukin-1 alpha (IL1A).	[1]
Primidone	DM0WX6I	Approved	Primidone increases the expression of Interleukin-1 alpha (IL1A).	[1]
Levofloxacin	DMS60RB	Approved	Levofloxacin increases the expression of Interleukin-1 alpha (IL1A).	[1]
Paliperidone	DM7NPJS	Approved	Paliperidone increases the expression of Interleukin-1 alpha (IL1A).	[1]
Biperiden	DME78OA	Approved	Biperiden increases the expression of Interleukin-1 alpha (IL1A).	[1]
Benzyl alcohol	DMBVYDI	Approved	Benzyl alcohol increases the expression of Interleukin-1 alpha (IL1A).	[27]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Interleukin-1 alpha (IL1A).	[28]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Interleukin-1 alpha (IL1A).	[29]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Interleukin-1 alpha (IL1A).	[29]
Chloroquine	DMSI5CB	Phase 3 Trial	Chloroquine increases the expression of Interleukin-1 alpha (IL1A).	[30]
Guaiacol	DMN4E7T	Phase 3	Guaiacol decreases the expression of Interleukin-1 alpha (IL1A).	[29]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Interleukin-1 alpha (IL1A).	[29]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Interleukin-1 alpha (IL1A).	[31]
Phenol	DM1QSM3	Phase 2/3	Phenol increases the expression of Interleukin-1 alpha (IL1A).	[32]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Interleukin-1 alpha (IL1A).	[24]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene decreases the expression of Interleukin-1 alpha (IL1A).	[33]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Interleukin-1 alpha (IL1A).	[34]
Puerarin	DMJIMXH	Phase 2	Puerarin decreases the expression of Interleukin-1 alpha (IL1A).	[29]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Interleukin-1 alpha (IL1A).	[35]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Interleukin-1 alpha (IL1A).	[36]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of Interleukin-1 alpha (IL1A).	[37]
Ticrynafen	DMLFSTR	Withdrawn from market	Ticrynafen increases the expression of Interleukin-1 alpha (IL1A).	[1]
Zomepirac	DM7APNJ	Withdrawn from market	Zomepirac increases the expression of Interleukin-1 alpha (IL1A).	[38]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Interleukin-1 alpha (IL1A).	[40]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Interleukin-1 alpha (IL1A).	[41]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Interleukin-1 alpha (IL1A).	[43]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Interleukin-1 alpha (IL1A).	[44]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Interleukin-1 alpha (IL1A).	[45]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Interleukin-1 alpha (IL1A).	[16]
geraniol	DMS3CBD	Investigative	geraniol increases the expression of Interleukin-1 alpha (IL1A).	[27]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine affects the expression of Interleukin-1 alpha (IL1A).	[46]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of Interleukin-1 alpha (IL1A).	[37]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of Interleukin-1 alpha (IL1A).	[47]
Cycloheximide	DMGDA3C	Investigative	Cycloheximide increases the expression of Interleukin-1 alpha (IL1A).	[48]
Aminohippuric acid	DMUN54G	Investigative	Aminohippuric acid increases the expression of Interleukin-1 alpha (IL1A).	[35]
2-tert-butylbenzene-1,4-diol	DMNXI1E	Investigative	2-tert-butylbenzene-1,4-diol increases the expression of Interleukin-1 alpha (IL1A).	[37]
Farnesol	DMV2X1B	Investigative	Farnesol increases the expression of Interleukin-1 alpha (IL1A).	[37]
Chlorogenic acid	DM2Y3P4	Investigative	Chlorogenic acid decreases the expression of Interleukin-1 alpha (IL1A).	[29]
NSC-1771	DMNXDGQ	Investigative	NSC-1771 increases the expression of Interleukin-1 alpha (IL1A).	[49]
PAF	DMRZAQW	Investigative	PAF increases the expression of Interleukin-1 alpha (IL1A).	[50]
[3H]estrone-3-sulphate	DMGPF0N	Investigative	[3H]estrone-3-sulphate decreases the expression of Interleukin-1 alpha (IL1A).	[4]
trichloroethanol	DMNALMF	Investigative	trichloroethanol increases the expression of Interleukin-1 alpha (IL1A).	[51]

3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Flucloxacillin	DMNUWST	Approved	Flucloxacillin increases the secretion of Interleukin-1 alpha (IL1A).	[25]
MDL-28170	DMYK31O	Terminated	MDL-28170 affects the localization of Interleukin-1 alpha (IL1A).	[39]
Milchsaure	DM462BT	Investigative	Milchsaure increases the secretion of Interleukin-1 alpha (IL1A).	[42]

References

• [1] An in vitro coculture system of human peripheral blood mononuclear cells with hepatocellular carcinoma-derived cells for predicting drug-induced liver injury. Arch Toxicol. 2021 Jan;95(1):149-168. doi: 10.1007/s00204-020-02882-4. Epub 2020 Aug 20.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Atheroprotective effect of estriol and estrone sulfate on human vascular smooth muscle cells. J Steroid Biochem Mol Biol. 2000 Jan-Feb;72(1-2):71-8. doi: 10.1016/s0960-0760(99)00149-1.
• [5] Gene expression profiles in peripheral lymphocytes by arsenic exposure and skin lesion status in a Bangladeshi population. Cancer Epidemiol Biomarkers Prev. 2006 Jul;15(7):1367-75. doi: 10.1158/1055-9965.EPI-06-0106.
• [6] Quercetin potentiates apoptosis by inhibiting nuclear factor-kappaB signaling in H460 lung cancer cells. Biol Pharm Bull. 2013;36(6):944-51. doi: 10.1248/bpb.b12-01004.
• [7] Arsenic trioxide induces different gene expression profiles of genes related to growth and apoptosis in glioma cells dependent on the p53 status. Mol Biol Rep. 2008 Sep;35(3):421-9.
• [8] Oxidative Stress Alters miRNA and Gene Expression Profiles in Villous First Trimester Trophoblasts. Biomed Res Int. 2015;2015:257090. doi: 10.1155/2015/257090. Epub 2015 Aug 3.
• [9] Gene microarray analysis of human renal cell carcinoma: the effects of HDAC inhibition and retinoid treatment. Cancer Biol Ther. 2008 Oct;7(10):1607-18.
• [10] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [11] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [12] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [13] Increased sensitivity for troglitazone-induced cytotoxicity using a human in vitro co-culture model. Toxicol In Vitro. 2009 Oct;23(7):1387-95.
• [14] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [15] Acanthoic acid protectsagainst ethanol-induced liver injury: Possible role of AMPK activation and IRAK4 inhibition. Toxicol Lett. 2017 Nov 5;281:127-138. doi: 10.1016/j.toxlet.2017.09.020. Epub 2017 Sep 28.
• [16] Cytokine mRNA profiles in cultured human skin component cells exposed to various chemicals: a simulation model of epicutaneous stimuli induced by skin barrier perturbation in comparison with that due to exposure to haptens or irritant. J Dermatol Sci. 2001 Jun;26(2):85-93. doi: 10.1016/s0923-1811(00)00165-1.
• [17] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [18] Mitomycin induces alveolar epithelial cell senescence by down-regulating GSK3 signaling. Toxicol Lett. 2021 Nov 1;352:61-69. doi: 10.1016/j.toxlet.2021.09.015. Epub 2021 Oct 5.
• [19] Metronomic gemcitabine suppresses tumour growth, improves perfusion, and reduces hypoxia in human pancreatic ductal adenocarcinoma. Br J Cancer. 2010 Jun 29;103(1):52-60.
• [20] Cytokine expression in the muscle of HIV-infected patients: evidence for interleukin-1 alpha accumulation in mitochondria of AZT fibers. Ann Neurol. 1994 Nov;36(5):752-8. doi: 10.1002/ana.410360511.
• [21] Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
• [22] Peripheral CLOCK regulates target-tissue glucocorticoid receptor transcriptional activity in a circadian fashion in man. PLoS One. 2011;6(9):e25612. doi: 10.1371/journal.pone.0025612. Epub 2011 Sep 28.
• [23] Isoproterenol effects evaluated in heart slices of human and rat in comparison to rat heart in vivo. Toxicol Appl Pharmacol. 2014 Jan 15;274(2):302-12.
• [24] Analysis of interleukin-1alpha (IL-1alpha) and interleukin-8 (IL-8) expression and release in in vitro reconstructed human epidermis for the prediction of in vivo skin irritation and/or sensitization. Toxicol In Vitro. 2003 Jun;17(3):311-21. doi: 10.1016/s0887-2333(03)00019-5.
• [25] Characterization of drug-specific signaling between primary human hepatocytes and immune cells. Toxicol Sci. 2017 Jul 1;158(1):76-89.
• [26] Major differences in gene expression in human coronary smooth muscle cells after nebivolol or metoprolol treatment. Int J Cardiol. 2008 Mar 28;125(1):4-10.
• [27] A comparative study of leukaemia inhibitory factor and interleukin-1alpha intracellular content in a human keratinocyte cell line after exposure to cosmetic fragrances and sodium dodecyl sulphate. Toxicol Lett. 2010 Feb 1;192(2):101-7. doi: 10.1016/j.toxlet.2009.10.013. Epub 2009 Oct 28.
• [28] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [29] Examining the genomic influence of skin antioxidants in vitro. Mediators Inflamm. 2010;2010.
• [30] Reactive oxygen species mediate chloroquine-induced expression of chemokines by human astroglial cells. Glia. 2004 Jul;47(1):9-20. doi: 10.1002/glia.20017.
• [31] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [32] Cytokine induction in human epidermal keratinocytes exposed to contact irritants and its relation to chemical-induced inflammation in mouse skin. J Invest Dermatol. 1994 Jun;102(6):915-22. doi: 10.1111/1523-1747.ep12383512.
• [33] Molecular mechanism of action of bisphenol and bisphenol A mediated by oestrogen receptor alpha in growth and apoptosis of breast cancer cells. Br J Pharmacol. 2013 May;169(1):167-78.
• [34] Expression of neutrophil SOD2 is reduced after lipopolysaccharide stimulation: a potential cause of neutrophil dysfunction in chronic kidney disease. Nephrol Dial Transplant. 2011 Jul;26(7):2195-201. doi: 10.1093/ndt/gfq673. Epub 2010 Nov 2.
• [35] Induction of fibroblast growth factor-9 and interleukin-1alpha gene expression by motorcycle exhaust particulate extracts and benzo(a)pyrene in human lung adenocarcinoma cells. Toxicol Sci. 2005 Oct;87(2):483-96. doi: 10.1093/toxsci/kfi251. Epub 2005 Jul 7.
• [36] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [37] The THP-1 cell toolbox: a new concept integrating the key events of skin sensitization. Arch Toxicol. 2019 Apr;93(4):941-951.
• [38] Neutrophil depletion protects against zomepirac-induced acute kidney injury in mice. Chem Biol Interact. 2018 Jan 5;279:102-110. doi: 10.1016/j.cbi.2017.11.011. Epub 2017 Nov 14.
• [39] Redox-control of the alarmin, Interleukin-1. Redox Biol. 2013 Apr 17;1(1):218-25. doi: 10.1016/j.redox.2013.03.001. eCollection 2013.
• [40] The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.
• [41] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [42] In vitro human skin irritation test for evaluation of medical device extracts. Toxicol In Vitro. 2013 Dec;27(8):2175-83. doi: 10.1016/j.tiv.2013.08.006. Epub 2013 Aug 30.
• [43] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [44] Ochratoxin A induced premature senescence in human renal proximal tubular cells. Toxicology. 2017 May 1;382:75-83. doi: 10.1016/j.tox.2017.03.009. Epub 2017 Mar 9.
• [45] Cytotoxicity and gene array analysis of alveolar epithelial A549 cells exposed to paraquat. Chem Biol Interact. 2010 Dec 5;188(3):427-36.
• [46] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [47] Characterizing the immunological effects of oral healthcare ingredients using an in vitro reconstructed human epithelial model. Food Chem Toxicol. 2014 Dec;74:139-48. doi: 10.1016/j.fct.2014.09.007. Epub 2014 Oct 5.
• [48] Comparative analysis of AhR-mediated TCDD-elicited gene expression in human liver adult stem cells. Toxicol Sci. 2009 Nov;112(1):229-44.
• [49] The IL-1?promoter-driven luciferase reporter cell line THP-G1b can efficiently predict skin-sensitising chemicals. Arch Toxicol. 2021 May;95(5):1647-1657. doi: 10.1007/s00204-021-03022-2. Epub 2021 Mar 13.
• [50] Oxidized phospholipid: POVPC binds to platelet-activating-factor receptor on human macrophagesImplications in atherosclerosis. Atherosclerosis. 2006 Oct;188(2):433-43.
• [51] Cytokine expression in trichloroethylene-induced hypersensitivity dermatitis: an in vivo and in vitro study. Toxicol Lett. 2012 Nov 23;215(1):31-9. doi: 10.1016/j.toxlet.2012.09.018. Epub 2012 Oct 2.
• [52] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
• [53] T-889C IL-1alpha promoter polymorphism influences the response to oral cyclophosphamide in scleroderma patients with alveolitis. Clin Rheumatol. 2007 Jan;26(1):88-91. doi: 10.1007/s10067-006-0308-0. Epub 2006 Apr 25.
• [54] Induction of cyclooxygenase-1 in cultured synovial cells isolated from rheumatoid arthritis patients. Inflamm Res. 2004 Jun;53(6):217-22. doi: 10.1007/s00011-004-1260-6. Epub 2004 May 12.
• [55] Effects of PCB126 and 17beta-oestradiol on endothelium-derived vasoactive factors in human endothelial cells. Toxicology. 2011 Jul 11;285(1-2):46-56.