Details of the Drug

General Information of Drug (ID: DML0D1P)

Drug Name
Reteplase
Synonyms Retevase; Rapilysin (TN); Retavase (TN); Retevase (TN); Reteplase (USAN/INN)
Indication
Disease Entry ICD 11 Status REF
Heart attack BA41 Approved [1]
Therapeutic Class
Thrombolytic Agents
Sequence
SYQGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYC
RNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAA
IFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKF
EVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELS
GYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHD
ACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP
Adverse Drug Reaction (ADR)
ADR Term Variation Related DOT DOT ID REF
Tumour necrosis Not Available TNF OT4IE164 [2]
Tumour necrosis Not Available IL1A OTPSGILV [2]
Cross-matching ID
DrugBank ID
DB00015
TTD ID
D0T1UJ

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Plasminogen (PLG) TTP86E2 PLMN_HUMAN Activator [3]

Drug Off-Target (DOT)
DOT Name DOT ID UniProt ID Interaction REF
Interleukin-1 alpha (IL1A) OTPSGILV IL1A_HUMAN Drug Response [2]
Tumor necrosis factor (TNF) OT4IE164 TNFA_HUMAN Drug Response [2]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Heart attack
ICD Disease Classification BA41
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Plasminogen (PLG) DTT PLG 8.61E-01 -0.01 -0.09
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Reteplase
DDI Drug Name DDI Drug ID Severity Mechanism Disease REF
Prasugrel DM7MT6E Major Increased risk of bleeding by the combination of Reteplase and Prasugrel. Myocardial infarction [BA41-BA43] [4]
Vorapaxar DMA16BR Major Increased risk of bleeding by the combination of Reteplase and Vorapaxar. Myocardial infarction [BA41-BA43] [5]
Coadministration of a Drug Treating the Disease Different from Reteplase (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Cilostazol DMZMSCT Moderate Increased risk of bleeding by the combination of Reteplase and Cilostazol. Arterial occlusive disease [BD40] [6]
Drotrecogin alfa DM59JCN Major Increased risk of bleeding by the combination of Reteplase and Drotrecogin alfa. Cerebral ischaemia [8B1Z] [7]
Pentosan polysulfate DM2HRKE Moderate Increased risk of bleeding by the combination of Reteplase and Pentosan polysulfate. Chronic pain [MG30] [8]
Phenylbutazone DMAYL0T Moderate Increased risk of bleeding by the combination of Reteplase and Phenylbutazone. Chronic pain [MG30] [9]
Ketoprofen DMRKXPT Moderate Increased risk of bleeding by the combination of Reteplase and Ketoprofen. Chronic pain [MG30] [9]
Levomilnacipran DMV26S8 Moderate Increased risk of bleeding by the combination of Reteplase and Levomilnacipran. Chronic pain [MG30] [10]
Anisindione DM2C48U Major Increased risk of bleeding by the combination of Reteplase and Anisindione. Coagulation defect [3B10] [11]
Regorafenib DMHSY1I Major Increased risk of bleeding by the combination of Reteplase and Regorafenib. Colorectal cancer [2B91] [4]
Intedanib DMSTA36 Moderate Increased risk of bleeding by the combination of Reteplase and Intedanib. Colorectal cancer [2B91] [12]
Ardeparin DMYRX8B Major Increased risk of bleeding by the combination of Reteplase and Ardeparin. Coronary thrombosis [BA43] [13]
Danaparoid DM6CLBN Major Increased risk of bleeding by the combination of Reteplase and Danaparoid. Deep vein thrombosis [BD71] [13]
Rivaroxaban DMQMBZ1 Major Increased risk of bleeding by the combination of Reteplase and Rivaroxaban. Deep vein thrombosis [BD71] [14]
Sertraline DM0FB1J Moderate Increased risk of bleeding by the combination of Reteplase and Sertraline. Depression [6A70-6A7Z] [10]
Fluoxetine DM3PD2C Moderate Increased risk of bleeding by the combination of Reteplase and Fluoxetine. Depression [6A70-6A7Z] [10]
Vilazodone DM4LECQ Moderate Increased risk of bleeding by the combination of Reteplase and Vilazodone. Depression [6A70-6A7Z] [10]
Paroxetine DM5PVQE Moderate Increased risk of bleeding by the combination of Reteplase and Paroxetine. Depression [6A70-6A7Z] [10]
Vortioxetine DM6F1PU Moderate Increased risk of bleeding by the combination of Reteplase and Vortioxetine. Depression [6A70-6A7Z] [10]
Duloxetine DM9BI7M Moderate Increased risk of bleeding by the combination of Reteplase and Duloxetine. Depression [6A70-6A7Z] [10]
Milnacipran DMBFE74 Moderate Increased risk of bleeding by the combination of Reteplase and Milnacipran. Depression [6A70-6A7Z] [10]
Escitalopram DMFK9HG Moderate Increased risk of bleeding by the combination of Reteplase and Escitalopram. Depression [6A70-6A7Z] [10]
Desvenlafaxine DMHD4PE Moderate Increased risk of bleeding by the combination of Reteplase and Desvenlafaxine. Depression [6A70-6A7Z] [10]
Clomipramine DMINRKW Moderate Increased risk of bleeding by the combination of Reteplase and Clomipramine. Depression [6A70-6A7Z] [10]
Fluvoxamine DMQTJSX Moderate Increased risk of bleeding by the combination of Reteplase and Fluvoxamine. Depression [6A70-6A7Z] [10]
Venlafaxine DMR6QH0 Moderate Increased risk of bleeding by the combination of Reteplase and Venlafaxine. Depression [6A70-6A7Z] [10]
Heme DMGC287 Moderate Increased risk of bleeding by the combination of Reteplase and Heme. Discovery agent [N.A.] [15]
Apigenin DMI3491 Minor Increased risk of bleeding by the combination of Reteplase and Apigenin. Discovery agent [N.A.] [16]
Citalopram derivative 1 DMITX1G Moderate Increased risk of bleeding by the combination of Reteplase and Citalopram derivative 1. Discovery agent [N.A.] [10]
PMID28870136-Compound-49 DMTUC9E Moderate Increased risk of bleeding by the combination of Reteplase and PMID28870136-Compound-49. Discovery agent [N.A.] [17]
Fenfluramine DM0762O Moderate Increased risk of bleeding by the combination of Reteplase and Fenfluramine. Epilepsy/seizure [8A61-8A6Z] [10]
Suprofen DMKXJZ7 Moderate Increased risk of bleeding by the combination of Reteplase and Suprofen. Eye anterior segment structural developmental anomaly [LA11] [9]
Mefenamic acid DMK7HFI Moderate Increased risk of bleeding by the combination of Reteplase and Mefenamic acid. Female pelvic pain [GA34] [9]
Avapritinib DMK2GZX Major Increased risk of bleeding by the combination of Reteplase and Avapritinib. Gastrointestinal stromal tumour [2B5B] [4]
Sulfinpyrazone DMEV954 Moderate Increased risk of bleeding by the combination of Reteplase and Sulfinpyrazone. Gout [FA25] [6]
Ramipril DM2R68E Moderate Increased risk of angioedema by the combination of Reteplase and Ramipril. Heart failure [BD10-BD1Z] [18]
Tipranavir DM8HJX6 Major Increased risk of bleeding by the combination of Reteplase and Tipranavir. Human immunodeficiency virus disease [1C60-1C62] [19]
Moexipril DM26E4B Moderate Increased risk of angioedema by the combination of Reteplase and Moexipril. Hypertension [BA00-BA04] [18]
Captopril DM458UM Moderate Increased risk of angioedema by the combination of Reteplase and Captopril. Hypertension [BA00-BA04] [18]
Trandolapril DM4L6EU Moderate Increased risk of angioedema by the combination of Reteplase and Trandolapril. Hypertension [BA00-BA04] [18]
Fosinopril DM9NJ52 Moderate Increased risk of angioedema by the combination of Reteplase and Fosinopril. Hypertension [BA00-BA04] [18]
Enalapril DMNFUZR Moderate Increased risk of angioedema by the combination of Reteplase and Enalapril. Hypertension [BA00-BA04] [18]
Perindopril DMOPZDT Moderate Increased risk of angioedema by the combination of Reteplase and Perindopril. Hypertension [BA00-BA04] [18]
Quinapril DMR8H31 Moderate Increased risk of angioedema by the combination of Reteplase and Quinapril. Hypertension [BA00-BA04] [18]
Lisinopril DMUOK4C Moderate Increased risk of angioedema by the combination of Reteplase and Lisinopril. Hypertension [BA00-BA04] [18]
Dipyridamole DMXY30O Moderate Increased risk of bleeding by the combination of Reteplase and Dipyridamole. Hypertension [BA00-BA04] [6]
Meclofenamic acid DM05FXR Moderate Increased risk of bleeding by the combination of Reteplase and Meclofenamic acid. Inflammatory spondyloarthritis [FA92] [9]
Ticlopidine DMO946V Moderate Increased risk of bleeding by the combination of Reteplase and Ticlopidine. Ischaemic/haemorrhagic stroke [8B20] [6]
Tositumomab DMMYZ3D Major Increased risk of bleeding by the combination of Reteplase and Tositumomab. Malignant haematopoietic neoplasm [2B33] [20]
Acalabrutinib DM7GCVW Major Increased risk of bleeding by the combination of Reteplase and Acalabrutinib. Mature B-cell lymphoma [2A85] [21]
Ibrutinib DMHZCPO Major Increased risk of bleeding by the combination of Reteplase and Ibrutinib. Mature B-cell lymphoma [2A85] [22]
Ponatinib DMYGJQO Major Increased risk of bleeding by the combination of Reteplase and Ponatinib. Mature B-cell lymphoma [2A85] [23]
Panobinostat DM58WKG Major Increased risk of bleeding by the combination of Reteplase and Panobinostat. Multiple myeloma [2A83] [18]
Dasatinib DMJV2EK Major Increased risk of bleeding by the combination of Reteplase and Dasatinib. Myeloproliferative neoplasm [2A20] [24]
Omacetaxine mepesuccinate DMPU2WX Major Increased risk of bleeding by the combination of Reteplase and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [8]
Sibutramine DMFJTDI Moderate Increased risk of bleeding by the combination of Reteplase and Sibutramine. Obesity [5B80-5B81] [10]
Dexfenfluramine DMJ7YDS Moderate Increased risk of bleeding by the combination of Reteplase and Dexfenfluramine. Obesity [5B80-5B81] [10]
Diclofenac DMPIHLS Moderate Increased risk of bleeding by the combination of Reteplase and Diclofenac. Osteoarthritis [FA00-FA05] [9]
Nepafenac DMYK490 Moderate Increased risk of bleeding by the combination of Reteplase and Nepafenac. Osteoarthritis [FA00-FA05] [9]
Naproxen DMZ5RGV Moderate Increased risk of bleeding by the combination of Reteplase and Naproxen. Osteoarthritis [FA00-FA05] [9]
MK-4827 DMLYGH4 Moderate Increased risk of bleeding by the combination of Reteplase and MK-4827. Ovarian cancer [2C73] [4]
Aspirin DM672AH Moderate Increased risk of bleeding by the combination of Reteplase and Aspirin. Pain [MG30-MG3Z] [6]
Etodolac DM6WJO9 Moderate Increased risk of bleeding by the combination of Reteplase and Etodolac. Pain [MG30-MG3Z] [9]
Diflunisal DM7EN8I Moderate Increased risk of bleeding by the combination of Reteplase and Diflunisal. Pain [MG30-MG3Z] [6]
Ibuprofen DM8VCBE Moderate Increased risk of bleeding by the combination of Reteplase and Ibuprofen. Pain [MG30-MG3Z] [9]
Nabumetone DMAT2XH Moderate Increased risk of bleeding by the combination of Reteplase and Nabumetone. Pain [MG30-MG3Z] [9]
Piroxicam DMTK234 Moderate Increased risk of bleeding by the combination of Reteplase and Piroxicam. Pain [MG30-MG3Z] [9]
Choline salicylate DM8P137 Moderate Increased risk of bleeding by the combination of Reteplase and Choline salicylate. Postoperative inflammation [1A00-CA43] [6]
Ketorolac DMI4EL5 Moderate Increased risk of bleeding by the combination of Reteplase and Ketorolac. Postoperative inflammation [1A00-CA43] [9]
Bromfenac DMKB79O Moderate Increased risk of bleeding by the combination of Reteplase and Bromfenac. Postoperative inflammation [1A00-CA43] [9]
Treprostinil DMTIQF3 Moderate Increased risk of bleeding by the combination of Reteplase and Treprostinil. Pulmonary hypertension [BB01] [6]
Epoprostenol DMUTYR2 Moderate Increased risk of bleeding by the combination of Reteplase and Epoprostenol. Pulmonary hypertension [BB01] [6]
Iloprost DMVPZBE Moderate Increased risk of bleeding by the combination of Reteplase and Iloprost. Pulmonary hypertension [BB01] [6]
Salsalate DM13P4C Moderate Increased risk of bleeding by the combination of Reteplase and Salsalate. Rheumatoid arthritis [FA20] [6]
Meloxicam DM2AR7L Moderate Increased risk of bleeding by the combination of Reteplase and Meloxicam. Rheumatoid arthritis [FA20] [9]
Sulindac DM2QHZU Moderate Increased risk of bleeding by the combination of Reteplase and Sulindac. Rheumatoid arthritis [FA20] [9]
Oxaprozin DM9UB0P Moderate Increased risk of bleeding by the combination of Reteplase and Oxaprozin. Rheumatoid arthritis [FA20] [9]
Flurbiprofen DMGN4BY Moderate Increased risk of bleeding by the combination of Reteplase and Flurbiprofen. Rheumatoid arthritis [FA20] [9]
Fenoprofen DML5VQ0 Moderate Increased risk of bleeding by the combination of Reteplase and Fenoprofen. Rheumatoid arthritis [FA20] [9]
Indomethacin DMSC4A7 Moderate Increased risk of bleeding by the combination of Reteplase and Indomethacin. Rheumatoid arthritis [FA20] [9]
Tolmetin DMWUIJE Moderate Increased risk of bleeding by the combination of Reteplase and Tolmetin. Rheumatoid arthritis [FA20] [9]
Salicyclic acid DM2F8XZ Moderate Increased risk of bleeding by the combination of Reteplase and Salicyclic acid. Seborrhoeic dermatitis [EA81] [6]
Curcumin DMQPH29 Minor Increased risk of bleeding by the combination of Reteplase and Curcumin. Solid tumour/cancer [2A00-2F9Z] [25]
Warfarin DMJYCVW Major Increased risk of bleeding by the combination of Reteplase and Warfarin. Supraventricular tachyarrhythmia [BC81] [11]
Caplacizumab DMPUKA7 Major Increased risk of bleeding by the combination of Reteplase and Caplacizumab. Thrombocytopenia [3B64] [18]
Apixaban DM89JLN Major Increased risk of bleeding by the combination of Reteplase and Apixaban. Thrombosis [DB61-GB90] [4]
Cangrelor DM8JRH0 Major Increased risk of bleeding by the combination of Reteplase and Cangrelor. Thrombosis [DB61-GB90] [4]
Brilinta DMBR01X Moderate Increased risk of bleeding by the combination of Reteplase and Brilinta. Thrombosis [DB61-GB90] [4]
Argatroban DMFI46A Major Increased risk of bleeding by the combination of Reteplase and Argatroban. Thrombosis [DB61-GB90] [26]
Dicumarol DMFQCB1 Major Increased risk of bleeding by the combination of Reteplase and Dicumarol. Thrombosis [DB61-GB90] [11]
Clopidogrel DMOL54H Moderate Increased risk of bleeding by the combination of Reteplase and Clopidogrel. Thrombosis [DB61-GB90] [6]
Cabozantinib DMIYDT4 Major Increased risk of bleeding by the combination of Reteplase and Cabozantinib. Thyroid cancer [2D10] [27]
Betrixaban DM2C4RF Major Increased risk of bleeding by the combination of Reteplase and Betrixaban. Venous thromboembolism [BD72] [28]
⏷ Show the Full List of 91 DDI Information of This Drug

References

1 Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
2 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
3 Fibrin binding and the regulation of plasminogen activators during thrombolytic therapy. Cardiovasc Hematol Agents Med Chem. 2008 Jul;6(3):212-23.
4 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
5 Product Information. Zontivity (vorapaxar). Merck & Company Inc, Whitehouse Station, NJ.
6 Harder S, Klinkhardt U "Thrombolytics: drug interactions of clinical significance." Drug Saf 23 (2000): 391-9. [PMID: 11085346]
7 Product Information. Xigris (drotrecogin alfa). Lilly, Eli and Company, Indianapolis, IN.
8 Product Information. Brukinsa (zanubrutinib). BeiGene USA, Inc, San Mateo, CA.
9 Product Information. Acular (ketorolac). Allergan Inc, Irvine, CA.
10 Alderman CP, Moritz CK, Ben-Tovim DI "Abnormal platelet aggregation associated with fluoxetine therapy." Ann Pharmacother 26 (1992): 1517-9. [PMID: 1482806]
11 Arora RR, Magun AM, Grossman M, Katz J "Cholesterol embolization syndrome after intravenous tissue plasminogen activator for acute myocardial infarction." Am Heart J 126 (1993): 225-8. [PMID: 8322670]
12 Product Information. Ofev (nintedanib). Boehringer Ingelheim, Ridgefield, CT.
13 Price AJ, Frcpath DO "Is there a clinical interaction between low molecular weight heparin and non-steroidal analgesics after total hip replacement?" Ann R Coll Surg Engl 77 (1995): 395. [PMID: 7486773]
14 Product Information. Xarelto (rivaroxaban). Bayer Inc, Toronto, IA.
15 Product Information. Panhematin (hemin). Recordati Rare Diseases Inc, Lebanon, NJ.
16 Heck AM, DeWitt BA, Lukes AL "Potential interactions between alternative therapies and warfarin." Am J Health Syst Pharm 57 (2000): 1221-7 quiz 1228-30. [PMID: 10902065]
17 Canadian Pharmacists Association.
18 Cerner Multum, Inc. "Australian Product Information.".
19 Product Information. Aptivus (tipranavir). Boehringer-Ingelheim, Ridgefield, CT.
20 Product Information. Bexxar I 131 Therapeutic (iodine I 131 tositumomab). GlaxoSmithKline, Research Triangle Park, NC.
21 Product Information. Calquence (acalabrutinib). Astra-Zeneca Pharmaceuticals, Wilmington, DE.
22 Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
23 Product Information. Iclusig (ponatinib). Ariad Pharmaceuticals Inc, Cambridge, MA.
24 Product Information. Sprycel (dasatinib). Bristol-Myers Squibb, Princeton, NJ.
25 Abebe W "Herbal medication: potential for adverse interactions with analgesic drugs." J Clin Pharm Ther 27 (2002): 391-401. [PMID: 12472978]
26 Product Information. Acova (argatroban) SmithKline Beecham, Philadelphia, PA.
27 Product Information. Cometriq (cabozantinib). Exelixis Inc, S San Francisco, CA.
28 Product Information. Bevyxxa (betrixaban). Portola Pharmaceuticals, South San Francisco, CA.