Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPUI00F)

• DOT Name: Microtubule-associated protein 6 (MAP6)
• Synonyms: MAP-6; Stable tubule-only polypeptide; STOP
• Gene Name: MAP6
• Related Disease:
  Epilepsy
  Malaria
  Advanced cancer
  Analgesia
  Anxiety
  Anxiety disorder
  Arrhythmia
  Atrial fibrillation
  B-cell neoplasm
  Bladder cancer
  Cardiac failure
  Chagas disease
  Colitis
  Colorectal carcinoma
  Congestive heart failure
  Depression
  Diabetic kidney disease
  Gastric adenocarcinoma
  High blood pressure
  Idiopathic thrombocytopenic purpura
  IgA nephropathy
  Matthew-Wood syndrome
  Mental disorder
  Neoplasm
  Obstructive sleep apnea
  Parkinson disease
  Prostate neoplasm
  Pyoderma gangrenosum
  Schizophrenia
  Stroke
  Trichohepatoenteric syndrome
  Ulcerative colitis
  Urinary bladder cancer
  Urinary bladder neoplasm
  Uveitis
  Acute myelogenous leukaemia
  Colon cancer
  Colon carcinoma
  Hepatocellular carcinoma
  Non-insulin dependent diabetes
  Type-1/2 diabetes
  Intellectual disability
  Type-1 diabetes
  Asthma
  Chronic hepatitis B virus infection
  Prediabetes syndrome
  Sickle-cell anaemia
• UniProt ID: MAP6_HUMAN
• Pfam ID: PF21410
• Sequence:
  MAWPCITRACCIARFWNQLDKADIAVPLVFTKYSEATEHPGAPPQPPPPQQQAQPALAPP
  SARAVAIETQPAQGELDAVARATGPAPGPTGEREPAAGPGRSGPGPGLGSGSTSGPADSV
  MRQDYRAWKVQRPEPSCRPRSEYQPSDAPFERETQYQKDFRAWPLPRRGDHPWIPKPVQI
  SAASQASAPILGAPKRRPQSQERWPVQAAAEAREQEAAPGGAGGLAAGKASGADERDTRR
  KAGPAWIVRRAEGLGHEQTPLPAAQAQVQATGPEAGRGRAAADALNRQIREEVASAVSSS
  YRNEFRAWTDIKPVKPIKAKPQYKPPDDKMVHETSYSAQFKGEASKPTTADNKVIDRRRI
  RSLYSEPFKEPPKVEKPSVQSSKPKKTSASHKPTRKAKDKQAVSGQAAKKKSAEGPSTTK
  PDDKEQSKEMNNKLAEAKESLAQPVSDSSKTQGPVATEPDKDQGSVVPGLLKGQGPMVQE
  PLKKQGSVVPGPPKDLGPMIPLPVKDQDHTVPEPLKNESPVISAPVKDQGPSVPVPPKNQ
  SPMVPAKVKDQGSVVPESLKDQGPRIPEPVKNQAPMVPAPVKDEGPMVSASVKDQGPMVS
  APVKDQGPIVPAPVKGEGPIVPAPVKDEGPMVSAPIKDQDPMVPEHPKDESAMATAPIKN
  QGSMVSEPVKNQGLVVSGPVKDQDVVVPEHAKVHDSAVVAPVKNQGPVVPESVKNQDPIL
  PVLVKDQGPTVLQPPKNQGRIVPEPLKNQVPIVPVPLKDQDPLVPVPAKDQGPAVPEPLK
  TQGPRDPQLPTVSPLPRVMIPTAPHTEYIESSP
• Function: Involved in microtubule stabilization in many cell types, including neuronal cells. Specifically has microtubule cold stabilizing activity. Involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking via its interaction with TMEM106B. Regulates KIF5A-mediated axonal cargo transport. Regulates axonal growth during neuron polarization.
• Tissue Specificity: Expressed in brain (at protein level). Expressed in spinal cord. Isoform 2 expression is up-regulated in the prefrontal cortex (Brodmann's area 46) of patients with schizophrenia (postmortem brain study).

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Epilepsy	DISBB28L	Definitive	Biomarker	[1]
Malaria	DISQ9Y50	Definitive	Genetic Variation	[2]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[3]
Analgesia	DISK3TVI	Strong	Genetic Variation	[4]
Anxiety	DISIJDBA	Strong	Biomarker	[5]
Anxiety disorder	DISBI2BT	Strong	Biomarker	[5]
Arrhythmia	DISFF2NI	Strong	Genetic Variation	[6]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[6]
B-cell neoplasm	DISVY326	Strong	Genetic Variation	[7]
Bladder cancer	DISUHNM0	Strong	Biomarker	[8]
Cardiac failure	DISDC067	Strong	Biomarker	[9]
Chagas disease	DIS8KNVF	Strong	Biomarker	[10]
Colitis	DISAF7DD	Strong	Biomarker	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[12]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[9]
Depression	DIS3XJ69	Strong	Biomarker	[5]
Diabetic kidney disease	DISJMWEY	Strong	Genetic Variation	[13]
Gastric adenocarcinoma	DISWWLTC	Strong	Biomarker	[14]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[6]
Idiopathic thrombocytopenic purpura	DISFKGJU	Strong	Genetic Variation	[15]
IgA nephropathy	DISZ8MTK	Strong	Biomarker	[16]
Matthew-Wood syndrome	DISA7HR7	Strong	Genetic Variation	[17]
Mental disorder	DIS3J5R8	Strong	Biomarker	[18]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[19]
Obstructive sleep apnea	DIS0SVD1	Strong	Genetic Variation	[20]
Parkinson disease	DISQVHKL	Strong	Biomarker	[21]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[22]
Pyoderma gangrenosum	DIS8QVTT	Strong	Genetic Variation	[23]
Schizophrenia	DISSRV2N	Strong	Biomarker	[24]
Stroke	DISX6UHX	Strong	Biomarker	[20]
Trichohepatoenteric syndrome	DISL3ODF	Strong	Genetic Variation	[25]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[11]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[8]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[8]
Uveitis	DISV0RYS	Strong	Biomarker	[26]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[27]
Colon cancer	DISVC52G	moderate	Genetic Variation	[28]
Colon carcinoma	DISJYKUO	moderate	Genetic Variation	[28]
Hepatocellular carcinoma	DIS0J828	moderate	Genetic Variation	[29]
Non-insulin dependent diabetes	DISK1O5Z	moderate	Genetic Variation	[30]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[30]
Intellectual disability	DISMBNXP	Disputed	Biomarker	[31]
Type-1 diabetes	DIS7HLUB	Disputed	Genetic Variation	[32]
Asthma	DISW9QNS	Limited	Biomarker	[33]
Chronic hepatitis B virus infection	DISHL4NT	Limited	Biomarker	[34]
Prediabetes syndrome	DISH2I53	Limited	Biomarker	[35]
Sickle-cell anaemia	DIS5YNZB	Limited	Genetic Variation	[36]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Microtubule-associated protein 6 (MAP6).	[37]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Microtubule-associated protein 6 (MAP6).	[38]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Microtubule-associated protein 6 (MAP6).	[39]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Microtubule-associated protein 6 (MAP6).	[40]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Microtubule-associated protein 6 (MAP6).	[41]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Microtubule-associated protein 6 (MAP6).	[42]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Microtubule-associated protein 6 (MAP6).	[42]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Microtubule-associated protein 6 (MAP6).	[44]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Microtubule-associated protein 6 (MAP6).	[45]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Microtubule-associated protein 6 (MAP6).	[46]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Microtubule-associated protein 6 (MAP6).	[43]

References

• [1] Obstructive sleep apnea in refractory epilepsy: A pilot study investigating frequency, clinical features, and association with risk of sudden unexpected death in epilepsy.Epilepsia. 2018 Oct;59(10):1973-1981. doi: 10.1111/epi.14548. Epub 2018 Sep 24.
• [2] Malaria Parasitemia and Parasite Density in Antiretroviral-Treated HIV-Infected Adults Following Discontinuation of Cotrimoxazole Prophylaxis.J Infect Dis. 2017 Jan 1;215(1):88-94. doi: 10.1093/infdis/jiw495. Epub 2016 Oct 25.
• [3] Outcomes and Safety Among Patients With Obstructive Sleep Apnea Undergoing Cancer Surgery Procedures in a Freestanding Ambulatory Surgical Facility.Anesth Analg. 2019 Aug;129(2):360-368. doi: 10.1213/ANE.0000000000004111.
• [4] Low-dose methoxyflurane analgesia in adolescent patients with moderate-to-severe trauma pain: a subgroup analysis of the STOP! study.J Pain Res. 2019 Feb 15;12:689-700. doi: 10.2147/JPR.S188675. eCollection 2019.
• [5] An Exploratory Study on the Effects of Forest Therapy on Sleep Quality in Patients with Gastrointestinal Tract Cancers.Int J Environ Res Public Health. 2019 Jul 10;16(14):2449. doi: 10.3390/ijerph16142449.
• [6] The STOP-BANG questionnaire shows an insufficient specificity for detecting obstructive sleep apnea in patients with atrial fibrillation.J Sleep Res. 2018 Dec;27(6):e12702. doi: 10.1111/jsr.12702. Epub 2018 Apr 22.
• [7] Incidence and risk factors for febrile neutropenia in Japanese patients with non-Hodgkin B cell lymphoma receiving R-CHOP: 2-year experience in a single center (STOP FN in NHL 2).Support Care Cancer. 2020 Feb;28(2):571-579. doi: 10.1007/s00520-019-04802-4. Epub 2019 May 15.
• [8] STOP smoking and alcohol drinking before OPeration for bladder cancer ?the STOP-OP study),?perioperative smoking and alcohol cessation intervention in relation to radical cystectomy: study protocol for a randomised controlled trial.Trials. 2017 Jul 17;18(1):329. doi: 10.1186/s13063-017-2065-6.
• [9] Early Postdischarge STOP-HF-Clinic Reduces 30-day Readmissions in Old and Frail Patients With Heart Failure.Rev Esp Cardiol (Engl Ed). 2017 Aug;70(8):631-638. doi: 10.1016/j.rec.2017.01.003. Epub 2017 Feb 16.
• [10] Development of a PCR Assay to Detect Low Level Trypanosoma cruzi in Blood Specimens Collected with PAXgene Blood DNA Tubes for Clinical Trials Treating Chagas Disease.PLoS Negl Trop Dis. 2016 Dec 1;10(12):e0005146. doi: 10.1371/journal.pntd.0005146. eCollection 2016 Dec.
• [11] STOP-Colitis pilot trial protocol: a prospective, open-label, randomised pilot study to assess two possible routes of faecal microbiota transplant delivery in patients with ulcerative colitis.BMJ Open. 2019 Nov 11;9(11):e030659. doi: 10.1136/bmjopen-2019-030659.
• [12] A cost-effectiveness analysis of a colorectal cancer screening program in safety net clinics.Prev Med. 2019 Mar;120:119-125. doi: 10.1016/j.ypmed.2019.01.014. Epub 2019 Jan 24.
• [13] Racial differences in nocturnal dipping status in diabetic kidney disease: Results from the STOP-DKD (Simultaneous Risk Factor Control Using Telehealth to Slow Progression of Diabetic Kidney Disease) study.J Clin Hypertens (Greenwich). 2017 Dec;19(12):1327-1335. doi: 10.1111/jch.13088. Epub 2017 Aug 20.
• [14] Abundant copy-number loss of CYCLOPS and STOP genes in gastric adenocarcinoma.Gastric Cancer. 2016 Apr;19(2):453-465. doi: 10.1007/s10120-015-0514-z. Epub 2015 Jul 24.
• [15] FCGR2C genotyping by pyrosequencing reveals linkage disequilibrium with FCGR3A V158F and FCGR2A H131R polymorphisms in a Caucasian population.MAbs. 2012 Nov-Dec;4(6):784-7. doi: 10.4161/mabs.22287. Epub 2012 Oct 2.
• [16] CTLA-4 Polymorphisms in Patients with IgA Nephropathy Correlate with Proteinuria.Kidney Blood Press Res. 2018;43(2):360-366. doi: 10.1159/000488069. Epub 2018 Mar 8.
• [17] Generation of a pancreatic cancer model using a Pdx1-Flp recombinase knock-in allele.PLoS One. 2017 Sep 21;12(9):e0184984. doi: 10.1371/journal.pone.0184984. eCollection 2017.
• [18] 3D imaging of the brain morphology and connectivity defects in a model of psychiatric disorders: MAP6-KO mice.Sci Rep. 2017 Sep 4;7(1):10308. doi: 10.1038/s41598-017-10544-2.
• [19] Potential of Aqueous Humor as a Surrogate Tumor Biopsy for Retinoblastoma.JAMA Ophthalmol. 2017 Nov 1;135(11):1221-1230. doi: 10.1001/jamaophthalmol.2017.4097.
• [20] Using a modified version of the "STOP-BANG" questionnaire and nocturnal oxygen desaturation to predict obstructive sleep apnea after stroke or TIA.Sleep Med. 2019 Apr;56:177-183. doi: 10.1016/j.sleep.2018.12.021. Epub 2019 Jan 7.
• [21] Role of microtubule-associated protein 6 glycosylated with Gal-(-1,3)-GalNAc in Parkinson's disease.Aging (Albany NY). 2019 Jul 9;11(13):4597-4610. doi: 10.18632/aging.102072.
• [22] Activation of pro-apoptotic p38-MAPK pathway in the prostate cancer cell line M12 expressing a truncated IGF-IR.Horm Metab Res. 2003 Nov-Dec;35(11-12):751-7. doi: 10.1055/s-2004-814160.
• [23] Ciclosporin compared with prednisolone therapy for patients with pyoderma gangrenosum: cost-effectiveness analysis of the STOP GAP trial.Br J Dermatol. 2017 Dec;177(6):1527-1536. doi: 10.1111/bjd.15561. Epub 2017 May 31.
• [24] Deletion of the microtubule-associated protein 6 (MAP6) results in skeletal muscle dysfunction.Skelet Muscle. 2018 Sep 19;8(1):30. doi: 10.1186/s13395-018-0176-8.
• [25] Multiple endocrine neoplasia type 1 in Poland: a two-centre experience.Endokrynol Pol. 2019;70(5):385-391. doi: 10.5603/EP.a2019.0031. Epub 2019 Jul 5.
• [26] Primary (Month-6) Outcomes of the STOP-Uveitis Study: Evaluating the Safety, Tolerability, and Efficacy of Tocilizumab in Patients With Noninfectious Uveitis.Am J Ophthalmol. 2017 Nov;183:71-80. doi: 10.1016/j.ajo.2017.08.019. Epub 2017 Sep 5.
• [27] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [28] Factors Affecting Adherence in a Pragmatic Trial of Annual Fecal Immunochemical Testing for Colorectal Cancer.J Gen Intern Med. 2019 Jun;34(6):978-985. doi: 10.1007/s11606-018-4820-0. Epub 2019 Jan 25.
• [29] Hepatitis C Virus Screening and Care: Complexity of Implementation in Primary Care Practices Serving Disadvantaged Populations.Ann Intern Med. 2019 Dec 17;171(12):865-874. doi: 10.7326/M18-3573. Epub 2019 Dec 3.
• [30] The STOP DIABETES study: when prevention works.Acta Diabetol. 2019 May;56(5):501-504. doi: 10.1007/s00592-019-01309-6. Epub 2019 Mar 2.
• [31] Type 2 diabetes and glucose intolerance in a population with intellectual disabilities: the STOP diabetes cross-sectional screening study.J Intellect Disabil Res. 2017 Jul;61(7):668-681. doi: 10.1111/jir.12380. Epub 2017 May 21.
• [32] Sodium-glucose co-transporter inhibitors, their role in type 1 diabetes treatment and a risk mitigation strategy for preventing diabetic ketoacidosis: The STOP DKA Protocol.Diabetes Obes Metab. 2019 Oct;21(10):2192-2202. doi: 10.1111/dom.13811. Epub 2019 Jun 30.
• [33] The association between asthma and obstructive sleep apnea (OSA): A systematic review.J Asthma. 2019 Feb;56(2):118-129. doi: 10.1080/02770903.2018.1444049. Epub 2018 Apr 11.
• [34] Limited sustained response after stopping nucleos(t)ide analogues in patients with chronic hepatitis B: results from a randomised controlled trial (Toronto STOP study).Gut. 2019 Dec;68(12):2206-2213. doi: 10.1136/gutjnl-2019-318981. Epub 2019 Aug 28.
• [35] Successful treatment of prediabetes in clinical practice using physiological assessment (STOP DIABETES).Lancet Diabetes Endocrinol. 2018 Oct;6(10):781-789. doi: 10.1016/S2213-8587(18)30234-1. Epub 2018 Sep 14.
• [36] Transcranial color Doppler in stroke-free adult patients with sickle cell disease.Ann Hematol. 2017 Sep;96(9):1547-1555. doi: 10.1007/s00277-017-3071-1. Epub 2017 Jul 20.
• [37] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [38] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [39] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [40] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [41] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [42] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [43] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [44] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [45] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [46] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.