Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPZ1PWR)

DOT Name Leucine-rich repeat-containing G-protein coupled receptor 6 (LGR6)
Gene Name LGR6
Related Disease
Acute myelogenous leukaemia ( )
Uveal Melanoma ( )
Adenocarcinoma ( )
Advanced cancer ( )
Analgesia ( )
Cardiac failure ( )
Cardiovascular disease ( )
Clear cell renal carcinoma ( )
Colorectal carcinoma ( )
Congestive heart failure ( )
Cystic fibrosis ( )
Epithelial ovarian cancer ( )
Hereditary hemochromatosis ( )
Kaposi sarcoma ( )
Lung adenocarcinoma ( )
Melanoma ( )
Metabolic disorder ( )
Multiple sclerosis ( )
Nephrogenic diabetes insipidus ( )
Non-insulin dependent diabetes ( )
Non-small-cell lung cancer ( )
Obesity ( )
Osteoporosis ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Pancreatic neuroendocrine tumor ( )
Prostate cancer ( )
Schizophrenia ( )
Squamous cell carcinoma ( )
Type-1/2 diabetes ( )
Autoimmune disease ( )
Breast neoplasm ( )
Carcinoma ( )
High blood pressure ( )
Leukemia ( )
Colorectal neoplasm ( )
Parkinson disease ( )
Prostate carcinoma ( )
Skin cancer ( )
Adult glioblastoma ( )
Alzheimer disease ( )
Asthma ( )
Breast cancer ( )
Breast carcinoma ( )
Endometrial carcinoma ( )
Gastric cancer ( )
Glioblastoma multiforme ( )
Inflammatory bowel disease ( )
Pancreatic cancer ( )
Stomach cancer ( )
UniProt ID
LGR6_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13855
Sequence
MPSPPGLRALWLCAALCASRRAGGAPQPGPGPTACPAPCHCQEDGIMLSADCSELGLSAV
PGDLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILM
LQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVR
ALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLD
LNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSA
FQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLELS
HNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRSIHPEAFST
LHSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAYQCC
PYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQLEMEDSKPH
PSVQCSPTPGPFKPCEYLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPVPLPPVKFV
VGAIAGANTLTGISCGLLASVDALTFGQFSEYGARWETGLGCRATGFLAVLGSEASVLLL
TLAAVQCSVSVSCVRAYGKSPSLGSVRAGVLGCLALAGLAAALPLASVGEYGASPLCLPY
APPEGQPAALGFTVALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAVWDCAMVRHVAWLIF
ADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRR
LRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVT
LISCQQPGAPRLEGSHCVEPEGNHFGNPQPSMDGELLLRAEGSTPAGGGLSGGGGFQPSG
LAFASHV
Function
Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and acts as a marker of multipotent stem cells in the epidermis. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. In contrast to classical G-protein coupled receptors, does not activate heterotrimeric G-proteins to transduce the signal. May act as a tumor suppressor.
KEGG Pathway
Wnt sig.ling pathway (hsa04310 )
Reactome Pathway
Regulation of FZD by ubiquitination (R-HSA-4641263 )

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute myelogenous leukaemia DISCSPTN Definitive Biomarker [1]
Uveal Melanoma DISA7ZGL Definitive Genetic Variation [2]
Adenocarcinoma DIS3IHTY Strong Altered Expression [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
Analgesia DISK3TVI Strong Biomarker [5]
Cardiac failure DISDC067 Strong Biomarker [6]
Cardiovascular disease DIS2IQDX Strong Biomarker [6]
Clear cell renal carcinoma DISBXRFJ Strong Biomarker [7]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [8]
Congestive heart failure DIS32MEA Strong Biomarker [6]
Cystic fibrosis DIS2OK1Q Strong Genetic Variation [9]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [10]
Hereditary hemochromatosis DISVG5MT Strong Biomarker [11]
Kaposi sarcoma DISC1H1Z Strong Biomarker [12]
Lung adenocarcinoma DISD51WR Strong Biomarker [13]
Melanoma DIS1RRCY Strong Biomarker [14]
Metabolic disorder DIS71G5H Strong Biomarker [15]
Multiple sclerosis DISB2WZI Strong Altered Expression [16]
Nephrogenic diabetes insipidus DISKNSJK Strong Biomarker [17]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [18]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [13]
Obesity DIS47Y1K Strong Biomarker [19]
Osteoporosis DISF2JE0 Strong Biomarker [20]
Ovarian cancer DISZJHAP Strong Biomarker [10]
Ovarian neoplasm DISEAFTY Strong Biomarker [10]
Pancreatic neuroendocrine tumor DISDMPU0 Strong Biomarker [21]
Prostate cancer DISF190Y Strong Biomarker [22]
Schizophrenia DISSRV2N Strong Biomarker [23]
Squamous cell carcinoma DISQVIFL Strong Biomarker [24]
Type-1/2 diabetes DISIUHAP Strong Biomarker [25]
Autoimmune disease DISORMTM moderate Biomarker [26]
Breast neoplasm DISNGJLM moderate Biomarker [27]
Carcinoma DISH9F1N moderate Genetic Variation [28]
High blood pressure DISY2OHH moderate Biomarker [29]
Leukemia DISNAKFL moderate Altered Expression [30]
Colorectal neoplasm DISR1UCN Disputed Biomarker [31]
Parkinson disease DISQVHKL Disputed Altered Expression [32]
Prostate carcinoma DISMJPLE Disputed Biomarker [22]
Skin cancer DISTM18U Disputed Altered Expression [33]
Adult glioblastoma DISVP4LU Limited Biomarker [34]
Alzheimer disease DISF8S70 Limited Biomarker [35]
Asthma DISW9QNS Limited Biomarker [36]
Breast cancer DIS7DPX1 Limited Biomarker [37]
Breast carcinoma DIS2UE88 Limited Biomarker [37]
Endometrial carcinoma DISXR5CY Limited Altered Expression [38]
Gastric cancer DISXGOUK Limited Biomarker [39]
Glioblastoma multiforme DISK8246 Limited Biomarker [34]
Inflammatory bowel disease DISGN23E Limited Biomarker [40]
Pancreatic cancer DISJC981 Limited Biomarker [41]
Stomach cancer DISKIJSX Limited Biomarker [39]
------------------------------------------------------------------------------------
⏷ Show the Full List of 50 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Leucine-rich repeat-containing G-protein coupled receptor 6 (LGR6). [42]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Leucine-rich repeat-containing G-protein coupled receptor 6 (LGR6). [43]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Leucine-rich repeat-containing G-protein coupled receptor 6 (LGR6). [44]
------------------------------------------------------------------------------------

References

1 Characterization of upregulated adhesion GPCRs in acute myeloid leukemia.Transl Res. 2019 Oct;212:26-35. doi: 10.1016/j.trsl.2019.05.004. Epub 2019 May 17.
2 Atypical activation of the G protein G(q) by the oncogenic mutation Q209P.J Biol Chem. 2018 Dec 21;293(51):19586-19599. doi: 10.1074/jbc.RA118.005291. Epub 2018 Oct 23.
3 G protein-coupled receptor LGR6 is an independent risk factor for colon adenocarcinoma.Front Med. 2019 Aug;13(4):482-491. doi: 10.1007/s11684-018-0633-0. Epub 2018 Jul 4.
4 Established and In-trial GPCR Families in Clinical Trials: A Review for Target Selection.Curr Drug Targets. 2019;20(5):522-539. doi: 10.2174/1389450120666181105152439.
5 Positive Modulation of Angiotensin II Type 1 Receptor-Mediated Signaling by LVV-Hemorphin-7.Front Pharmacol. 2019 Oct 25;10:1258. doi: 10.3389/fphar.2019.01258. eCollection 2019.
6 GRK2 as a therapeutic target for heart failure.Expert Opin Ther Targets. 2018 Jan;22(1):75-83. doi: 10.1080/14728222.2018.1406925. Epub 2017 Nov 23.
7 The G-protein-coupled receptor CLR is upregulated in an autocrine loop with adrenomedullin in clear cell renal cell carcinoma and associated with poor prognosis.Clin Cancer Res. 2013 Oct 15;19(20):5740-8. doi: 10.1158/1078-0432.CCR-13-1712. Epub 2013 Aug 22.
8 Downregulation of Lgr6 inhibits proliferation and invasion and increases apoptosis in human colorectal cancer.Int J Mol Med. 2018 Jul;42(1):625-632. doi: 10.3892/ijmm.2018.3633. Epub 2018 Apr 18.
9 2-Adrenergic receptor agonists activate CFTR in intestinal organoids and subjects with cystic fibrosis.Eur Respir J. 2016 Sep;48(3):768-79. doi: 10.1183/13993003.01661-2015. Epub 2016 Jul 28.
10 Silencing LGR6 Attenuates Stemness and Chemoresistance via Inhibiting Wnt/-Catenin Signaling in Ovarian Cancer.Mol Ther Oncolytics. 2019 Apr 19;14:94-106. doi: 10.1016/j.omto.2019.04.002. eCollection 2019 Sep 27.
11 An intracellular activation of Smoothened that is independent of Hedgehog stimulation in Drosophila.J Cell Sci. 2018 Jan 4;131(1):jcs211367. doi: 10.1242/jcs.211367.
12 The Kaposi's sarcoma-associated herpesvirus G protein-coupled receptor: Lessons on dysregulated angiogenesis from a viral oncogene.J Cell Biochem. 2010 May;110(1):1-9. doi: 10.1002/jcb.22524.
13 miR-17-92/p38 Dysregulation Enhances Wnt Signaling and Selects Lgr6+ Cancer Stem-like Cells during Lung Adenocarcinoma Progression.Cancer Res. 2016 Jul 1;76(13):4012-22. doi: 10.1158/0008-5472.CAN-15-3302. Epub 2016 May 4.
14 GPR56 and its related diseases.Prog Mol Biol Transl Sci. 2009;89:1-13. doi: 10.1016/S1877-1173(09)89001-7. Epub 2009 Oct 7.
15 Evaluation of novel TGR5 agonist in combination with Sitagliptin for possible treatment of type 2 diabetes.Bioorg Med Chem Lett. 2018 Jun 1;28(10):1849-1852. doi: 10.1016/j.bmcl.2018.04.011. Epub 2018 Apr 5.
16 Computer design, synthesis, and bioactivity analyses of drugs like fingolimod used in the treatment of multiple sclerosis.Bioorg Med Chem. 2017 Jan 15;25(2):483-495. doi: 10.1016/j.bmc.2016.11.015. Epub 2016 Nov 18.
17 Signaling Modification by GPCR Heteromer and Its Implication on X-Linked Nephrogenic Diabetes Insipidus.PLoS One. 2016 Sep 20;11(9):e0163086. doi: 10.1371/journal.pone.0163086. eCollection 2016.
18 Discovery and biological evaluation of novel G protein-coupled receptor 119 agonists for type 2 diabetes.Arch Pharm (Weinheim). 2019 Apr;352(4):e1800267. doi: 10.1002/ardp.201800267. Epub 2019 Feb 10.
19 Peptide/Receptor Co-evolution Explains the Lipolytic Function of the Neuropeptide TLQP-21.Cell Rep. 2019 Sep 3;28(10):2567-2580.e6. doi: 10.1016/j.celrep.2019.07.101.
20 Gonadotropins and their receptors: coevolution, genetic variants, receptor imaging, and functional antagonists.Biol Reprod. 2018 Jul 1;99(1):3-12. doi: 10.1093/biolre/ioy012.
21 Differentiation of small bowel and pancreatic neuroendocrine tumors by gene-expression profiling.Surgery. 2012 Dec;152(6):998-1007. doi: 10.1016/j.surg.2012.08.040.
22 Activation of PSGR with -ionone suppresses prostate cancer progression by blocking androgen receptor nuclear translocation.Cancer Lett. 2019 Jul 1;453:193-205. doi: 10.1016/j.canlet.2019.03.044. Epub 2019 Mar 27.
23 Differential allosteric modulation within dopamine D(2)R - neurotensin NTS1R and D(2)R - serotonin 5-HT(2A)R receptor complexes gives bias to intracellular calcium signalling.Sci Rep. 2019 Nov 8;9(1):16312. doi: 10.1038/s41598-019-52540-8.
24 Lgr6 is a stem cell marker in mouse skin squamous cell carcinoma.Nat Genet. 2017 Nov;49(11):1624-1632. doi: 10.1038/ng.3957. Epub 2017 Sep 25.
25 Current status of G-protein coupled receptors as potential targets against type 2 diabetes mellitus.Int J Biol Macromol. 2018 Oct 15;118(Pt B):2237-2244. doi: 10.1016/j.ijbiomac.2018.07.091. Epub 2018 Jul 17.
26 Characterization, Dynamics, and Mechanism of CXCR4 Antagonists on a Constitutively Active Mutant.Cell Chem Biol. 2019 May 16;26(5):662-673.e7. doi: 10.1016/j.chembiol.2019.01.012. Epub 2019 Feb 28.
27 Genome-wide association studies identify four ER negative-specific breast cancer risk loci.Nat Genet. 2013 Apr;45(4):392-8, 398e1-2. doi: 10.1038/ng.2561.
28 MALT1 is a critical mediator of PAR1-driven NF-B activation and metastasis in multiple tumor types.Oncogene. 2019 Dec;38(49):7384-7398. doi: 10.1038/s41388-019-0958-4. Epub 2019 Aug 16.
29 G-Protein-Coupled Receptors in Heart Disease.Circ Res. 2018 Aug 31;123(6):716-735. doi: 10.1161/CIRCRESAHA.118.311403.
30 Visualization of ligand-induced G(i)-protein activation in chemotaxing cells.FASEB J. 2017 Mar;31(3):910-919. doi: 10.1096/fj.201601102R. Epub 2016 Nov 23.
31 Genomic and epigenomic integration identifies a prognostic signature in colon cancer.Clin Cancer Res. 2011 Mar 15;17(6):1535-45. doi: 10.1158/1078-0432.CCR-10-2509. Epub 2011 Jan 28.
32 Analysis of positive and negative allosteric modulation in metabotropic glutamate receptors 4 and 5 with a dual ligand.Sci Rep. 2017 Jul 10;7(1):4944. doi: 10.1038/s41598-017-05095-5.
33 Expression of proton-sensing G-protein-coupled receptors in selected skin tumors.Exp Dermatol. 2019 Jan;28(1):66-71. doi: 10.1111/exd.13809. Epub 2018 Dec 13.
34 YAP and MRTF-A, transcriptional co-activators of RhoA-mediated gene expression, are critical for glioblastoma tumorigenicity.Oncogene. 2018 Oct;37(41):5492-5507. doi: 10.1038/s41388-018-0301-5. Epub 2018 Jun 11.
35 Monoamines and their Derivatives on GPCRs: Potential Therapy for Alzheimer's Disease.Curr Alzheimer Res. 2019;16(10):871-894. doi: 10.2174/1570159X17666190409144558.
36 G Protein-Coupled Receptors in Asthma Therapy: Pharmacology and Drug Action.Pharmacol Rev. 2020 Jan;72(1):1-49. doi: 10.1124/pr.118.016899.
37 Human G protein-coupled receptor 30 is N-glycosylated and N-terminal domain asparagine 44 is required for receptor structure and activity.Biosci Rep. 2019 Feb 26;39(2):BSR20182436. doi: 10.1042/BSR20182436. Print 2019 Feb 28.
38 Increased expression of human luteinizing hormone/human chorionic gonadotropin receptor mRNA in human endometrial cancer.Mol Cell Probes. 2002 Aug;16(4):269-75. doi: 10.1006/mcpr.2002.0421.
39 LGR6 promotes the progression of gastric cancer through PI3K/AKT/mTOR pathway.Onco Targets Ther. 2018 May 22;11:3025-3033. doi: 10.2147/OTT.S149303. eCollection 2018.
40 Microbiota metabolite short chain fatty acids, GPCR, and inflammatory bowel diseases.J Gastroenterol. 2017 Jan;52(1):1-8. doi: 10.1007/s00535-016-1242-9. Epub 2016 Jul 23.
41 Insulin Receptor and GPCR Crosstalk Stimulates YAP via PI3K and PKD in Pancreatic Cancer Cells.Mol Cancer Res. 2017 Jul;15(7):929-941. doi: 10.1158/1541-7786.MCR-17-0023. Epub 2017 Mar 30.
42 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
43 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
44 Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.