Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSCM68G)

• DOT Name: Quinone oxidoreductase PIG3 (TP53I3)
• Synonyms: EC 1.6.5.5; NADPH:quinone reductase PIG3; Tumor protein p53-inducible protein 3; Protein PIG3; p53-induced gene 3 protein
• Gene Name: TP53I3
• Related Disease:
  Bone osteosarcoma
  Osteosarcoma
  Undifferentiated carcinoma
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Clear cell renal carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Congenital contractural arachnodactyly
  Esophageal squamous cell carcinoma
  Ewing sarcoma
  Gastric cancer
  Head-neck squamous cell carcinoma
  Lung adenocarcinoma
  Neoplasm
  Non-small-cell lung cancer
  Renal cell carcinoma
  Stomach cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Prostate cancer
  Prostate carcinoma
  Adult glioblastoma
  Carcinoma
  Glioblastoma multiforme
  Melanoma
  Thyroid gland papillary carcinoma
• UniProt ID: QORX_HUMAN
• PDB ID: 2J8Z; 2OBY
• EC Number: 1.6.5.5
• Pfam ID: PF08240 ; PF00107
• Sequence:
  MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNI
  LGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAA
  IPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQM
  AEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGL
  MGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPV
  LDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ
• Function: Catalyzes the NADPH-dependent reduction of quinones. Exhibits a low enzymatic activity with beta-naphthoquinones, with a strong preference for the ortho-quinone isomer (1,2-beta-naphthoquinone) over the para isomer (1,4-beta-naphthoquinone). Also displays a low reductase activity for non-quinone compounds such as diamine and 2,6-dichloroindophenol (in vitro). Involved in the generation of reactive oxygen species (ROS).
• KEGG Pathway: p53 sig.ling pathway (hsa04115)
• Reactome Pathway: TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain (R-HSA-6803205)

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bone osteosarcoma	DIST1004	Definitive	Biomarker	[1]
Osteosarcoma	DISLQ7E2	Definitive	Biomarker	[1]
Undifferentiated carcinoma	DISIAZST	Definitive	Biomarker	[2]
Bladder cancer	DISUHNM0	Strong	Genetic Variation	[3]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[4]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[4]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[5]
Colon cancer	DISVC52G	Strong	Biomarker	[6]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[7]
Congenital contractural arachnodactyly	DISOM1K7	Strong	Biomarker	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[9]
Ewing sarcoma	DISQYLV3	Strong	Genetic Variation	[10]
Gastric cancer	DISXGOUK	Strong	Biomarker	[11]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Genetic Variation	[12]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[13]
Neoplasm	DISZKGEW	Strong	Biomarker	[6]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[13]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[5]
Stomach cancer	DISKIJSX	Strong	Biomarker	[11]
Urinary bladder cancer	DISDV4T7	Strong	Genetic Variation	[3]
Urinary bladder neoplasm	DIS7HACE	Strong	Genetic Variation	[3]
Prostate cancer	DISF190Y	moderate	Biomarker	[14]
Prostate carcinoma	DISMJPLE	moderate	Biomarker	[14]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[15]
Carcinoma	DISH9F1N	Limited	Biomarker	[2]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[15]
Melanoma	DIS1RRCY	Limited	Biomarker	[16]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Biomarker	[17]

43 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[18]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[19]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[20]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[21]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[22]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[23]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[24]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[25]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[26]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[27]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[28]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Quinone oxidoreductase PIG3 (TP53I3).	[29]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[30]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[31]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[22]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[32]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[33]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[34]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[35]
Mitomycin	DMH0ZJE	Approved	Mitomycin increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[36]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[19]
Fenofibrate	DMFKXDY	Approved	Fenofibrate decreases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[19]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[19]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[19]
Lucanthone	DMZLBUO	Approved	Lucanthone increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[37]
Daunorubicin	DMQUSBT	Approved	Daunorubicin increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[33]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[38]
Nitric Oxide	DM1RBYG	Approved	Nitric Oxide increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[39]
Amsacrine	DMZKYIV	Approved	Amsacrine increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[33]
Amifostine	DM5FL14	Approved	Amifostine decreases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[40]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[41]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[33]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[42]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[43]
PF-3758309	DM36PKZ	Phase 1	PF-3758309 increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[44]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[26]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[45]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[46]
Chrysin	DM7V2LG	Investigative	Chrysin increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[26]
Kaempferol	DMHEMUB	Investigative	Kaempferol increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[26]
Apigenin	DMI3491	Investigative	Apigenin increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[47]
Myricetin	DMTV4L0	Investigative	Myricetin increases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[47]
Taurine	DMVW7N3	Investigative	Taurine decreases the expression of Quinone oxidoreductase PIG3 (TP53I3).	[48]

References

• [1] Identification of critical genes associated with human osteosarcoma metastasis based on integrated gene expression profiling.Mol Med Rep. 2019 Aug;20(2):915-930. doi: 10.3892/mmr.2019.10323. Epub 2019 Jun 3.
• [2] Methylation silencing of angiopoietin-like 4 in rat and human mammary carcinomas.Cancer Sci. 2011 Jul;102(7):1337-43. doi: 10.1111/j.1349-7006.2011.01955.x. Epub 2011 May 12.
• [3] Association of the PIG3 promoter polymorphism with invasive bladder cancer in a Japanese population.Jpn J Clin Oncol. 2006 Feb;36(2):116-20. doi: 10.1093/jjco/hyi225. Epub 2006 Jan 17.
• [4] BRCA1 regulates PIG3-mediated apoptosis in a p53-dependent manner.Oncotarget. 2015 Apr 10;6(10):7608-18. doi: 10.18632/oncotarget.3263.
• [5] Loss of PIG3 increases HIF-1 level by promoting protein synthesis via mTOR pathway in renal cell carcinoma cells.Oncotarget. 2016 May 10;7(19):27176-84. doi: 10.18632/oncotarget.8401.
• [6] The oncogenic effects of p53-inducible gene 3 (PIG3) in colon cancer cells.Korean J Physiol Pharmacol. 2017 Mar;21(2):267-273. doi: 10.4196/kjpp.2017.21.2.267. Epub 2017 Feb 21.
• [7] HPIP is upregulated in colorectal cancer and regulates colorectal cancer cell proliferation, apoptosis and invasion.Sci Rep. 2015 Mar 24;5:9429. doi: 10.1038/srep09429.
• [8] Aberrant methylation of HTATIP2 and UCHL1 as a predictive biomarker for cholangiocarcinoma.Mol Med Rep. 2018 Mar;17(3):4145-4153. doi: 10.3892/mmr.2017.8319. Epub 2017 Dec 19.
• [9] A cancer-array approach elucidates the immune escape mechanism and defects in the DNA repair system in esophageal squamous cell carcinoma.Arch Iran Med. 2013 Aug;16(8):463-70.
• [10] Constitutive and DNA damage inducible activation of pig3 and MDM2 genes by tumor-derived p53 mutant C277Y.Mol Cancer Res. 2004 May;2(5):296-304.
• [11] PIG3 suppresses gastric cancer proliferation by regulating p53- mediated apoptosis.J Biol Regul Homeost Agents. 2018 Sep-Oct;32(5):1185-1189.
• [12] Functional repeats (TGYCC)n in the p53-inducible gene 3 (PIG3) promoter and susceptibility to squamous cell carcinoma of the head and neck.Carcinogenesis. 2013 Apr;34(4):812-7. doi: 10.1093/carcin/bgs388. Epub 2012 Dec 14.
• [13] p53-inducible gene 3 promotes cell migration and invasion by activating the FAK/Src pathway in lung adenocarcinoma.Cancer Sci. 2018 Dec;109(12):3783-3793. doi: 10.1111/cas.13818. Epub 2018 Oct 26.
• [14] p53-induced gene 3 mediates cell death induced by glutathione peroxidase 3.J Biol Chem. 2012 May 11;287(20):16890-902. doi: 10.1074/jbc.M111.322636. Epub 2012 Mar 29.
• [15] Suppression of p53-inducible gene 3 is significant for glioblastoma progression and predicts poor patient prognosis.Tumour Biol. 2017 Mar;39(3):1010428317694572. doi: 10.1177/1010428317694572.
• [16] Reactivation of p53 by a Cytoskeletal Sensor to Control the Balance Between DNA Damage and Tumor Dissemination.J Natl Cancer Inst. 2015 Oct 13;108(1):djv289. doi: 10.1093/jnci/djv289. Print 2016 Jan.
• [17] PIG3 plays an oncogenic role in papillary thyroid cancer by activating the PI3K/AKT/PTEN pathway.Oncol Rep. 2015 Sep;34(3):1424-30. doi: 10.3892/or.2015.4096. Epub 2015 Jun 30.
• [18] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [19] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [20] The retinoid anticancer signal: mechanisms of target gene regulation. Br J Cancer. 2005 Aug 8;93(3):310-8. doi: 10.1038/sj.bjc.6602700.
• [21] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [22] Cell-type-specific responses to chemotherapeutics in breast cancer. Cancer Res. 2004 Jun 15;64(12):4218-26.
• [23] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [24] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [25] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [26] Flavones and flavonols exert cytotoxic effects on a human oesophageal adenocarcinoma cell line (OE33) by causing G2/M arrest and inducing apoptosis. Food Chem Toxicol. 2008 Jun;46(6):2042-53. doi: 10.1016/j.fct.2008.01.049. Epub 2008 Feb 7.
• [27] Inhibition of fatty acid synthase expression by 1alpha,25-dihydroxyvitamin D3 in prostate cancer cells. J Steroid Biochem Mol Biol. 2003 May;85(1):1-8. doi: 10.1016/s0960-0760(03)00142-0.
• [28] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [29] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [30] Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
• [31] Progestins regulate genes that can elicit both proliferative and antiproliferative effects in breast cancer cells. Oncol Rep. 2008 Jun;19(6):1627-34.
• [32] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [33] Characterization of DNA reactive and non-DNA reactive anticancer drugs by gene expression profiling. Mutat Res. 2007 Jun 1;619(1-2):16-29. doi: 10.1016/j.mrfmmm.2006.12.007. Epub 2007 Feb 8.
• [34] Cancer genes induced by malathion and parathion in the presence of estrogen in breast cells. Int J Mol Med. 2008 Feb;21(2):261-8. doi: 10.3892/ijmm.21.2.261.
• [35] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [36] Differential expression of TP53 associated genes in Fanconi anemia cells after mitomycin C and hydroxyurea treatment. Mutat Res. 2008 Oct 30;656(1-2):1-7.
• [37] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [38] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [39] Apoptotic signaling pathways induced by nitric oxide in human lymphoblastoid cells expressing wild-type or mutant p53. Cancer Res. 2004 May 1;64(9):3022-9. doi: 10.1158/0008-5472.can-03-1880.
• [40] Amifostine impairs p53-mediated apoptosis of human myeloid leukemia cells. Mol Cancer Ther. 2003 Sep;2(9):893-900.
• [41] Differential regulation of proliferation, cell cycle control and gene expression in cultured human aortic and pulmonary artery endothelial cells by resveratrol. Int J Mol Med. 2010 Nov;26(5):743-9.
• [42] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [43] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [44] Inhibition of neuroblastoma proliferation by PF-3758309, a small-molecule inhibitor that targets p21-activated kinase 4. Oncol Rep. 2017 Nov;38(5):2705-2716. doi: 10.3892/or.2017.5989. Epub 2017 Sep 22.
• [45] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [46] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [47] Cytotoxicity of flavones and flavonols to a human esophageal squamous cell carcinoma cell line (KYSE-510) by induction of G2/M arrest and apoptosis. Toxicol In Vitro. 2009 Aug;23(5):797-807. doi: 10.1016/j.tiv.2009.04.007. Epub 2009 May 3.
• [48] Taurine-responsive genes related to signal transduction as identified by cDNA microarray analyses of HepG2 cells. J Med Food. 2006 Spring;9(1):33-41. doi: 10.1089/jmf.2006.9.33.