Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSFFZRD)

DOT Name	Galactosylceramide sulfotransferase (GAL3ST1)
Synonyms	GalCer sulfotransferase; EC 2.8.2.11; 3'-phosphoadenosine-5'-phosphosulfate:GalCer sulfotransferase; 3'-phosphoadenylylsulfate:galactosylceramide 3'-sulfotransferase; Cerebroside sulfotransferase
Gene Name	GAL3ST1
Related Disease	Cone-rod dystrophy 2 ( ) Hepatitis B virus infection ( ) Hepatocellular carcinoma ( ) Hyperglycemia ( ) Obesity ( ) Progressive bulbar palsy ( ) Acute myocardial infarction ( ) Adenocarcinoma ( ) Advanced cancer ( ) Alzheimer disease ( ) Arteriosclerosis ( ) Atherosclerosis ( ) Behcet disease ( ) Breast cancer ( ) Breast carcinoma ( ) Cardiac failure ( ) Cerebral infarction ( ) Clear cell renal carcinoma ( ) Congestive heart failure ( ) Coronary heart disease ( ) Diabetic macular edema ( ) Episodic kinesigenic dyskinesia 1 ( ) Essential hypertension ( ) Gastric cancer ( ) Glioma ( ) Invasive ductal breast carcinoma ( ) Myocardial infarction ( ) Neoplasm ( ) Papillon-Lefevre disease ( ) Potassium-aggravated myotonia ( ) Renal cell carcinoma ( ) Stomach cancer ( ) Ulcerative colitis ( ) Amyotrophic lateral sclerosis ( ) Cardiovascular disease ( ) Fetal growth restriction ( ) High blood pressure ( ) Immune system disorder ( ) Neuralgia ( ) Type-1/2 diabetes ( ) Type-1 diabetes ( ) Anhidrosis ( ) Influenza ( ) Marfan syndrome ( ) Non-insulin dependent diabetes ( ) Osteoarthritis ( ) Stroke ( )
UniProt ID	G3ST1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	2.8.2.11
Pfam ID	PF06990
Sequence	MLPPQKKPWESMAKGLVLGALFTSFLLLVYSYAVPPLHAGLASTTPEAAASCSPPALEPE AVIRANGSAGECQPRRNIVFLKTHKTASSTLLNILFRFGQKHRLKFAFPNGRNDFDYPTF FARSLVQDYRPGACFNIICNHMRFHYDEVRGLVPTNAIFITVLRDPARLFESSFHYFGPV VPLTWKLSAGDKLTEFLQDPDRYYDPNGFNAHYLRNLLFFDLGYDNSLDPSSPQVQEHIL EVERRFHLVLLQEYFDESLVLLKDLLCWELEDVLYFKLNARRDSPVPRLSGELYGRATAW NMLDSHLYRHFNASFWRKVEAFGRERMAREVAALRHANERMRTICIDGGHAVDAAAIQDE AMQPWQPLGTKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLMDLGANLWVTKLWKFIRDF LRW
Function	Catalyzes the transfer of a sulfate group to position 3 of non-reducing beta-galactosyl residues in glycerolipids and sphingolipids, therefore participates in the biosynthesis of sulfoglycolipids. Catalyzes the synthesis of galactosylceramide sulfate (sulfatide), a major lipid component of the myelin sheath and of monogalactosylalkylacylglycerol sulfate (seminolipid), present in spermatocytes. Seems to prefer beta-glycosides at the non-reducing termini of sugar chains attached to a lipid moiety. Also acts on lactosylceramide, galactosyl 1-alkyl-2-sn-glycerol and galactosyl diacylglycerol (in vitro).
Tissue Specificity	Expressed in kidney proximal tubule, gastric mucosa and adenocarcinoma . Highly expressed in renal cell carcinoma cell lines .
KEGG Pathway	Ether lipid metabolism (hsa00565 ) Sphingolipid metabolism (hsa00600 ) Metabolic pathways (hsa01100 )
BioCyc Pathway	MetaCyc:HS05164-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Cone-rod dystrophy 2	DISX2RWY	Definitive	Biomarker	[1]
Hepatitis B virus infection	DISLQ2XY	Definitive	Biomarker	[2]
Hepatocellular carcinoma	DIS0J828	Definitive	Genetic Variation	[2]
Hyperglycemia	DIS0BZB5	Definitive	Biomarker	[3]
Obesity	DIS47Y1K	Definitive	Biomarker	[3]
Progressive bulbar palsy	DIS4SNUB	Definitive	Biomarker	[4]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[5]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[6]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[7]
Alzheimer disease	DISF8S70	Strong	Biomarker	[8]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[9]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[9]
Behcet disease	DISSYMBS	Strong	Biomarker	[10]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[11]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[11]
Cardiac failure	DISDC067	Strong	Biomarker	[12]
Cerebral infarction	DISR1WNP	Strong	Biomarker	[13]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[7]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[12]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[9]
Diabetic macular edema	DIS162FN	Strong	Biomarker	[14]
Episodic kinesigenic dyskinesia 1	DISGVQMP	Strong	Biomarker	[15]
Essential hypertension	DIS7WI98	Strong	Biomarker	[12]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[6]
Glioma	DIS5RPEH	Strong	Genetic Variation	[16]
Invasive ductal breast carcinoma	DIS43J58	Strong	Altered Expression	[11]
Myocardial infarction	DIS655KI	Strong	Altered Expression	[17]
Neoplasm	DISZKGEW	Strong	Biomarker	[7]
Papillon-Lefevre disease	DIS3R7KX	Strong	Biomarker	[18]
Potassium-aggravated myotonia	DISRO6ZH	Strong	Biomarker	[19]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[20]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[6]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[21]
Amyotrophic lateral sclerosis	DISF7HVM	moderate	Biomarker	[4]
Cardiovascular disease	DIS2IQDX	moderate	Biomarker	[22]
Fetal growth restriction	DIS5WEJ5	moderate	Biomarker	[23]
High blood pressure	DISY2OHH	moderate	Altered Expression	[24]
Immune system disorder	DISAEGPH	moderate	Biomarker	[25]
Neuralgia	DISWO58J	moderate	Biomarker	[26]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[25]
Type-1 diabetes	DIS7HLUB	Disputed	Biomarker	[27]
Anhidrosis	DISYLSTC	Limited	Biomarker	[28]
Influenza	DIS3PNU3	Limited	Biomarker	[29]
Marfan syndrome	DISVEUWZ	Limited	Biomarker	[30]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Altered Expression	[31]
Osteoarthritis	DIS05URM	Limited	Biomarker	[32]
Stroke	DISX6UHX	Limited	Biomarker	[33]
------------------------------------------------------------------------------------


⏷ Show the Full List of 47 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fenretinide	DMRD5SP	Phase 3	Galactosylceramide sulfotransferase (GAL3ST1) decreases the response to substance of Fenretinide.	[46]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Galactosylceramide sulfotransferase (GAL3ST1).	[34]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Galactosylceramide sulfotransferase (GAL3ST1).	[44]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Galactosylceramide sulfotransferase (GAL3ST1).	[45]
------------------------------------------------------------------------------------

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Galactosylceramide sulfotransferase (GAL3ST1).	[35]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Galactosylceramide sulfotransferase (GAL3ST1).	[36]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Galactosylceramide sulfotransferase (GAL3ST1).	[37]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Galactosylceramide sulfotransferase (GAL3ST1).	[38]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Galactosylceramide sulfotransferase (GAL3ST1).	[39]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Galactosylceramide sulfotransferase (GAL3ST1).	[40]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Galactosylceramide sulfotransferase (GAL3ST1).	[39]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of Galactosylceramide sulfotransferase (GAL3ST1).	[41]
Gemcitabine	DMSE3I7	Approved	Gemcitabine decreases the expression of Galactosylceramide sulfotransferase (GAL3ST1).	[42]
DNCB	DMDTVYC	Phase 2	DNCB affects the expression of Galactosylceramide sulfotransferase (GAL3ST1).	[43]
acrolein	DMAMCSR	Investigative	acrolein affects the expression of Galactosylceramide sulfotransferase (GAL3ST1).	[43]
methyl salicylate	DMKCG8H	Investigative	methyl salicylate affects the expression of Galactosylceramide sulfotransferase (GAL3ST1).	[43]
------------------------------------------------------------------------------------


⏷ Show the Full List of 12 Drug(s)

References

1	AAV-KLF7 Promotes Descending Propriospinal Neuron Axonal Plasticity after Spinal Cord Injury.Neural Plast. 2017;2017:1621629. doi: 10.1155/2017/1621629. Epub 2017 Aug 13.
2	Investigation of the clinical significance and prospective molecular mechanisms of cystatin genes in patients with hepatitis B virusrelated hepatocellular carcinoma.Oncol Rep. 2019 Jul;42(1):189-201. doi: 10.3892/or.2019.7154. Epub 2019 May 9.
3	Catestatin Inhibits Obesity-Induced Macrophage Infiltration and Inflammation in the Liver and Suppresses Hepatic Glucose Production, Leading to Improved Insulin Sensitivity.Diabetes. 2018 May;67(5):841-848. doi: 10.2337/db17-0788. Epub 2018 Feb 6.
4	The same cortico-efferent tract involvement in progressive bulbar palsy and in 'classical' ALS: A tract of interest-based MRI study.Neuroimage Clin. 2019;24:101979. doi: 10.1016/j.nicl.2019.101979. Epub 2019 Aug 9.
5	Cortistatin Improves Cardiac Function After Acute Myocardial Infarction in Rats by Suppressing Myocardial Apoptosis and Endoplasmic Reticulum Stress.J Cardiovasc Pharmacol Ther. 2017 Jan;22(1):83-93. doi: 10.1177/1074248416644988. Epub 2016 Jun 23.
6	Detection of cerebroside sulfotransferase mRNA in human gastric mucosa and adenocarcinoma.Cancer Lett. 1999 Apr 26;138(1-2):45-51. doi: 10.1016/s0304-3835(98)00373-5.
7	A Hypoxia-Inducible HIF1-GAL3ST1-Sulfatide Axis Enhances ccRCC Immune Evasion via Increased Tumor Cell-Platelet Binding.Mol Cancer Res. 2019 Nov;17(11):2306-2317. doi: 10.1158/1541-7786.MCR-19-0461. Epub 2019 Aug 19.
8	Expression of Somatostatin, cortistatin, and their receptors, as well as dopamine receptors, but not of neprilysin, are reduced in the temporal lobe of Alzheimer's disease patients.J Alzheimers Dis. 2010;20(2):465-75. doi: 10.3233/JAD-2010-1385.
9	Decreased circulating catestatin levels are associated with coronary artery disease: The emerging anti-inflammatory role.Atherosclerosis. 2019 Feb;281:78-88. doi: 10.1016/j.atherosclerosis.2018.12.025. Epub 2018 Dec 24.
10	Serum Cortistatin Levels in Patients with Ocular Active and Ocular Inactive Behet Disease.Ocul Immunol Inflamm. 2020 May 18;28(4):601-605. doi: 10.1080/09273948.2019.1610461. Epub 2019 Jul 17.
11	Sulfatide decreases the resistance to stress-induced apoptosis and increases P-selectin-mediated adhesion: a two-edged sword in breast cancer progression.Breast Cancer Res. 2018 Nov 6;20(1):133. doi: 10.1186/s13058-018-1058-z.
12	Catestatin: A Master Regulator of Cardiovascular Functions.Curr Med Chem. 2018;25(11):1352-1374. doi: 10.2174/0929867324666170425100416.
13	Overexpression of cortistatin alleviates oxygen/glucose-deprivation-induced ER stress and prompts neural stem cell proliferation via SSTR2.Exp Mol Pathol. 2020 Apr;113:104351. doi: 10.1016/j.yexmp.2019.104351. Epub 2019 Dec 3.
14	Glucose-regulated protein 78 in the aqueous humor in diabetic macular edema patients.Medicine (Baltimore). 2018 Nov;97(45):e12757. doi: 10.1097/MD.0000000000012757.
15	Cortistatin inhibits arterial calcification in rats via GSK3/-catenin and protein kinase C signalling but not c-Jun N-terminal kinase signalling.Acta Physiol (Oxf). 2018 Jul;223(3):e13055. doi: 10.1111/apha.13055. Epub 2018 Mar 8.
16	Longer genotypically-estimated leukocyte telomere length is associated with increased adult glioma risk.Oncotarget. 2015 Dec 15;6(40):42468-77. doi: 10.18632/oncotarget.6468.
17	Catestatin in Acutely Decompensated Heart Failure Patients: Insights from the CATSTAT-HF Study.J Clin Med. 2019 Jul 30;8(8):1132. doi: 10.3390/jcm8081132.
18	Identical patterns of cortico-efferent tract involvement in primary lateral sclerosis and amyotrophic lateral sclerosis: A tract of interest-based MRI study.Neuroimage Clin. 2018 Mar 15;18:762-769. doi: 10.1016/j.nicl.2018.03.018. eCollection 2018.
19	Nanoprecipitated catestatin released from pharmacologically active microcarriers (PAMs) exerts pro-survival effects on MSC.Int J Pharm. 2017 May 25;523(2):506-514. doi: 10.1016/j.ijpharm.2016.11.050. Epub 2016 Nov 22.
20	Cancer-associated expression of glycolipid sulfotransferase gene in human renal cell carcinoma cells.Cancer Res. 1998 Sep 1;58(17):3800-5.
21	Catestatin Regulates Epithelial Cell Dynamics to Improve Intestinal Inflammation.Vaccines (Basel). 2018 Sep 20;6(4):67. doi: 10.3390/vaccines6040067.
22	Cortistatin, a novel cardiovascular protective peptide.Cardiovasc Diagn Ther. 2019 Aug;9(4):394-399. doi: 10.21037/cdt.2018.12.08.
23	Enhanced expression of intercellular adhesion molecule-1 (ICAM-1) in amnion with term and preterm labour.Placenta. 2000 Jan;21(1):115-21. doi: 10.1053/plac.1999.0457.
24	Effects of hypertension and antihypertensive treatments on sulfatide levels in serum and its metabolism.Hypertens Res. 2019 May;42(5):598-609. doi: 10.1038/s41440-018-0160-z. Epub 2018 Dec 10.
25	Catestatin as a Target for Treatment of Inflammatory Diseases.Front Immunol. 2018 Oct 4;9:2199. doi: 10.3389/fimmu.2018.02199. eCollection 2018.
26	Catestatin Enhances Neuropathic Pain Mediated by P2X4 Receptor of Dorsal Root Ganglia in a Rat Model of Chronic Constriction Injury.Cell Physiol Biochem. 2018;51(2):812-826. doi: 10.1159/000495334. Epub 2018 Nov 21.
27	Immense Insulin Intestinal Uptake and Lymphatic Transport Using Bile Acid Conjugated Partially Uncapped Liposome.Mol Pharm. 2018 Oct 1;15(10):4756-4763. doi: 10.1021/acs.molpharmaceut.8b00708. Epub 2018 Aug 29.
28	Anhidrosis and absence of sweat glands in mice hemizygous for the Tabby gene: supportive evidence for the hypothesis of homology between Tabby and human anhidrotic (hypohidrotic) ectodermal dysplasia (Christ-Siemens-Touraine syndrome).J Invest Dermatol. 1986 Dec;87(6):720-2. doi: 10.1111/1523-1747.ep12456718.
29	Cirsimaritin inhibits influenza A virus replication by downregulating the NF-B signal transduction pathway.Virol J. 2018 May 21;15(1):88. doi: 10.1186/s12985-018-0995-6.
30	Ocular manifestation in Marfan syndrome: corneal biomechanical properties relate to increased systemic score points.Graefes Arch Clin Exp Ophthalmol. 2018 Jun;256(6):1159-1163. doi: 10.1007/s00417-018-3946-4. Epub 2018 Mar 10.
31	Circulating levels of cortistatin are correlated with metabolic parameters in patients with newly diagnosed type 2 diabetes mellitus.Peptides. 2017 Aug;94:86-90. doi: 10.1016/j.peptides.2017.05.008. Epub 2017 May 17.
32	Cortistatin binds to TNF- receptors and protects against osteoarthritis.EBioMedicine. 2019 Mar;41:556-570. doi: 10.1016/j.ebiom.2019.02.035. Epub 2019 Feb 28.
33	Variability in stroke motor outcome is explained by structural and functional integrity of the motor system.Sci Rep. 2018 Jun 21;8(1):9480. doi: 10.1038/s41598-018-27541-8.
34	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
35	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
36	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
37	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
38	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
39	Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
40	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
41	Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
42	Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
43	Gene profiles of THP-1 macrophages after in vitro exposure to respiratory (non-)sensitizing chemicals: identification of discriminating genetic markers and pathway analysis. Toxicol In Vitro. 2009 Sep;23(6):1151-62. doi: 10.1016/j.tiv.2009.06.007. Epub 2009 Jun 13.
44	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
45	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
46	Inhibitory effects of N-(4-hydrophenyl) retinamide on liver cancer and malignant melanoma cells. World J Gastroenterol. 2005 Oct 7;11(37):5763-9. doi: 10.3748/wjg.v11.i37.5763.