General Information of Drug Off-Target (DOT) (ID: OTSNMCG9)

DOT Name Calretinin (CALB2)
Synonyms CR; 29 kDa calbindin
Gene Name CALB2
Related Disease
Epilepsy ( )
Amyotrophic lateral sclerosis type 1 ( )
Autism ( )
Autism spectrum disorder ( )
Breast carcinoma ( )
Breast neoplasm ( )
Bronchopulmonary dysplasia ( )
Carcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Colonic neoplasm ( )
Depression ( )
Epithelial ovarian cancer ( )
Familial amyotrophic lateral sclerosis ( )
Huntington disease ( )
Lung cancer ( )
Lung carcinoma ( )
Major depressive disorder ( )
Malignant soft tissue neoplasm ( )
Metastatic malignant neoplasm ( )
Neoplasm ( )
Neuralgia ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Pancreatic tumour ( )
Parkinson disease ( )
Peritoneal neoplasm ( )
Pervasive developmental disorder ( )
Polyp ( )
Pulmonary disease ( )
Sarcoma ( )
Sarcomatoid mesothelioma ( )
Schizophrenia ( )
Status epilepticus seizure ( )
Uveitis ( )
Wilms tumor ( )
Lung adenocarcinoma ( )
Colorectal carcinoma ( )
Alzheimer disease ( )
Amyotrophic lateral sclerosis ( )
Asthma ( )
Cognitive impairment ( )
Colon adenocarcinoma ( )
Mesothelioma ( )
Nervous system inflammation ( )
Neurodevelopmental disorder ( )
UniProt ID
CALB2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13405 ; PF13499
Sequence
MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSK
SDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYD
TDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLL
PVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQL
TNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM
Function Calretinin is a calcium-binding protein which is abundant in auditory neurons.
Tissue Specificity Brain.

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Epilepsy DISBB28L Definitive Biomarker [1]
Amyotrophic lateral sclerosis type 1 DIS5A2M0 Strong Biomarker [2]
Autism DISV4V1Z Strong Biomarker [3]
Autism spectrum disorder DISXK8NV Strong Biomarker [3]
Breast carcinoma DIS2UE88 Strong Altered Expression [4]
Breast neoplasm DISNGJLM Strong Altered Expression [5]
Bronchopulmonary dysplasia DISO0BY5 Strong Biomarker [6]
Carcinoma DISH9F1N Strong Biomarker [7]
Colon cancer DISVC52G Strong Altered Expression [8]
Colon carcinoma DISJYKUO Strong Altered Expression [9]
Colonic neoplasm DISSZ04P Strong Biomarker [10]
Depression DIS3XJ69 Strong Biomarker [11]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [12]
Familial amyotrophic lateral sclerosis DISWZ9CJ Strong Biomarker [2]
Huntington disease DISQPLA4 Strong Biomarker [13]
Lung cancer DISCM4YA Strong Biomarker [14]
Lung carcinoma DISTR26C Strong Biomarker [15]
Major depressive disorder DIS4CL3X Strong Altered Expression [6]
Malignant soft tissue neoplasm DISTC6NO Strong Altered Expression [16]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [17]
Neoplasm DISZKGEW Strong Biomarker [18]
Neuralgia DISWO58J Strong Biomarker [19]
Ovarian cancer DISZJHAP Strong Biomarker [12]
Ovarian neoplasm DISEAFTY Strong Biomarker [12]
Pancreatic tumour DIS3U0LK Strong Biomarker [20]
Parkinson disease DISQVHKL Strong Biomarker [13]
Peritoneal neoplasm DIS2ZMIF Strong Biomarker [21]
Pervasive developmental disorder DIS51975 Strong Biomarker [3]
Polyp DISRSLYF Strong Biomarker [22]
Pulmonary disease DIS6060I Strong Altered Expression [14]
Sarcoma DISZDG3U Strong Altered Expression [16]
Sarcomatoid mesothelioma DISCCHZN Strong Altered Expression [23]
Schizophrenia DISSRV2N Strong Biomarker [24]
Status epilepticus seizure DISY3BIC Strong Biomarker [25]
Uveitis DISV0RYS Strong Biomarker [26]
Wilms tumor DISB6T16 Strong Biomarker [27]
Lung adenocarcinoma DISD51WR moderate Biomarker [28]
Colorectal carcinoma DIS5PYL0 Disputed Altered Expression [29]
Alzheimer disease DISF8S70 Limited Biomarker [30]
Amyotrophic lateral sclerosis DISF7HVM Limited Biomarker [31]
Asthma DISW9QNS Limited Biomarker [32]
Cognitive impairment DISH2ERD Limited Biomarker [33]
Colon adenocarcinoma DISDRE0J Limited Biomarker [34]
Mesothelioma DISKWK9M Limited Biomarker [35]
Nervous system inflammation DISB3X5A Limited Biomarker [36]
Neurodevelopmental disorder DIS372XH Limited Biomarker [33]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
18 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Calretinin (CALB2). [37]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Calretinin (CALB2). [38]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Calretinin (CALB2). [39]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate affects the expression of Calretinin (CALB2). [40]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Calretinin (CALB2). [41]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Calretinin (CALB2). [42]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Calretinin (CALB2). [43]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the expression of Calretinin (CALB2). [44]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Calretinin (CALB2). [45]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Calretinin (CALB2). [46]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of Calretinin (CALB2). [47]
DTI-015 DMXZRW0 Approved DTI-015 decreases the expression of Calretinin (CALB2). [48]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Calretinin (CALB2). [49]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Calretinin (CALB2). [50]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Calretinin (CALB2). [51]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Calretinin (CALB2). [52]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Calretinin (CALB2). [53]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of Calretinin (CALB2). [41]
------------------------------------------------------------------------------------
⏷ Show the Full List of 18 Drug(s)

References

1 Characterization of focal cortical dysplasia with balloon cells by layer-specific markers: Evidence for differential vulnerability of interneurons.Epilepsia. 2017 Apr;58(4):635-645. doi: 10.1111/epi.13690. Epub 2017 Feb 16.
2 Differential expression of inflammation- and apoptosis-related genes in spinal cords of a mutant SOD1 transgenic mouse model of familial amyotrophic lateral sclerosis.J Neurochem. 2002 Jan;80(1):158-67. doi: 10.1046/j.0022-3042.2001.00683.x.
3 Calretinin interneuron density in the caudate nucleus is lower in autism spectrum disorder.Brain. 2017 Jul 1;140(7):2028-2040. doi: 10.1093/brain/awx131.
4 Expression of calretinin in high-grade hormone receptor-negative invasive breast carcinomas: correlation with histological and molecular subtypes.Virchows Arch. 2017 Jul;471(1):13-21. doi: 10.1007/s00428-017-2149-4. Epub 2017 May 26.
5 Solid papillary carcinoma with reverse polarity of the breast harbors specific morphologic, immunohistochemical and molecular profile in comparison with other benign or malignant papillary lesions of the breast: a comparative study of 9 additional cases.Mod Pathol. 2018 Sep;31(9):1367-1380. doi: 10.1038/s41379-018-0047-1. Epub 2018 May 21.
6 GABA-related transcripts in the dorsolateral prefrontal cortex in mood disorders.Int J Neuropsychopharmacol. 2011 Jul;14(6):721-34. doi: 10.1017/S1461145710001616.
7 A Comparison of GATA3, TTF1, CD10, and Calretinin in Identifying Mesonephric and Mesonephric-like Carcinomas of the Gynecologic Tract.Am J Surg Pathol. 2018 Dec;42(12):1596-1606. doi: 10.1097/PAS.0000000000001142.
8 A bipartite butyrate-responsive element in the human calretinin (CALB2) promoter acts as a repressor in colon carcinoma cells but not in mesothelioma cells.J Cell Biochem. 2010 Feb 15;109(3):519-31. doi: 10.1002/jcb.22429.
9 Are oestrogens and genetic predisposition etiologic factors in the development of clear cell carcinoma of the peritoneum?.Med Hypotheses. 2013 Feb;80(2):167-71. doi: 10.1016/j.mehy.2012.11.021. Epub 2012 Dec 21.
10 Heterozygosity of SNP513 in intron 9 of the human calretinin gene (CALB2) is a risk factor for colon cancer.Anticancer Res. 2007 Nov-Dec;27(6C):4279-88.
11 Overexpression of Calretinin Enhances Short-Term Synaptic Depression.Front Cell Neurosci. 2019 Mar 13;13:91. doi: 10.3389/fncel.2019.00091. eCollection 2019.
12 Serum calretinin as an independent predictor for platinum resistance and prognosis in ovarian cancer.Int J Cancer. 2020 May 1;146(9):2608-2618. doi: 10.1002/ijc.32676. Epub 2019 Nov 6.
13 Thecalretinin interneurons of the striatum: comparisons between rodents and primates under normal and pathological conditions.J Neural Transm (Vienna). 2018 Mar;125(3):279-290. doi: 10.1007/s00702-017-1687-x. Epub 2017 Feb 6.
14 Expression and significance of MOC-31 and calretinin in pleural fluid of patients with lung cancer.Diagn Cytopathol. 2015 Jul;43(7):527-31. doi: 10.1002/dc.23218. Epub 2014 Oct 24.
15 The Role of CD90 in the Differential Diagnosis of Pleural Malignant Mesothelioma, Pulmonary Carcinoma and Comparison with Calretnn.Pathol Oncol Res. 2017 Jul;23(3):487-491. doi: 10.1007/s12253-016-0135-9. Epub 2016 Oct 19.
16 CIC-rearranged Sarcomas: A Study of 20 Cases and Comparisons With Ewing Sarcomas.Am J Surg Pathol. 2016 Mar;40(3):313-23. doi: 10.1097/PAS.0000000000000570.
17 Identification of calretinin and the alternatively spliced form calretinin-22k in primary pleural mesotheliomas and in their metastases.Anticancer Res. 2004 Nov-Dec;24(6):4003-9.
18 Modulation of Calretinin Expression in Human Mesothelioma Cells Reveals the Implication of the FAK and Wnt Signaling Pathways in Conferring Chemoresistance towards Cisplatin.Int J Mol Sci. 2019 Oct 29;20(21):5391. doi: 10.3390/ijms20215391.
19 Expression of Calretinin Among Different Neurochemical Classes of Interneuron in the Superficial Dorsal Horn of the Mouse Spinal Cord.Neuroscience. 2019 Feb 1;398:171-181. doi: 10.1016/j.neuroscience.2018.12.009. Epub 2018 Dec 13.
20 Solid pseudopapillary neoplasm (SPN) of the testis: Comprehensive mutational analysis of 6 testicular and 8 pancreatic SPNs.Ann Diagn Pathol. 2018 Aug;35:42-47. doi: 10.1016/j.anndiagpath.2018.04.003. Epub 2018 Apr 20.
21 Two cases of malignant peritoneal mesothelioma without asbestos exposure: cytologic and immunohistochemical features.Ann Diagn Pathol. 2013 Feb;17(1):99-103. doi: 10.1016/j.anndiagpath.2012.05.007. Epub 2012 Jul 10.
22 Calretinin and CD34 immunoreactivity of the endometrial stroma in normal endometrium and change of the immunoreactivity in dysfunctional uterine bleeding with evidence of 'disordered endometrial stroma'.Pathology. 2008 Aug;40(5):493-9. doi: 10.1080/00313020802197897.
23 MUC4, a novel immunohistochemical marker identified by gene expression profiling, differentiates pleural sarcomatoid mesothelioma from lung sarcomatoid carcinoma.Mod Pathol. 2017 May;30(5):672-681. doi: 10.1038/modpathol.2016.181. Epub 2017 Jan 27.
24 Effect of pre- and post-treatment with Bacopa monnieri (Brahmi) on phencyclidine-induced disruptions in object recognition memory and cerebral calbindin, parvalbumin, and calretinin immunoreactivity in rats.Neuropsychiatr Dis Treat. 2019 May 1;15:1103-1117. doi: 10.2147/NDT.S193222. eCollection 2019.
25 Target-specific alterations in the VIP inhibitory drive to hippocampal GABAergic cells after status epilepticus.Exp Neurol. 2017 Jun;292:102-112. doi: 10.1016/j.expneurol.2017.03.007. Epub 2017 Mar 15.
26 Mitochondrial proteomics in experimental autoimmune uveitis oxidative stress.Invest Ophthalmol Vis Sci. 2009 Dec;50(12):5559-66. doi: 10.1167/iovs.08-2842. Epub 2009 Jul 2.
27 Cystic metastasis of prostate cancer: A case report.Medicine (Baltimore). 2018 Dec;97(50):e13697. doi: 10.1097/MD.0000000000013697.
28 Tenascin XB Is a Novel Diagnostic Marker for Malignant Mesothelioma.Anticancer Res. 2019 Feb;39(2):627-633. doi: 10.21873/anticanres.13156.
29 Calbindin 2 (CALB2) regulates 5-fluorouracil sensitivity in colorectal cancer by modulating the intrinsic apoptotic pathway.PLoS One. 2011;6(5):e20276. doi: 10.1371/journal.pone.0020276. Epub 2011 May 24.
30 Age, but Not Amyloidosis, Induced Changes in Global Levels of Histone Modifications in Susceptible and Disease-Resistant Neurons in Alzheimer's Disease Model Mice.Front Aging Neurosci. 2019 Apr 3;11:68. doi: 10.3389/fnagi.2019.00068. eCollection 2019.
31 Calretinin and Neuropeptide Y interneurons are differentially altered in the motor cortex of the SOD1(G93A) mouse model of ALS.Sci Rep. 2017 Mar 15;7:44461. doi: 10.1038/srep44461.
32 Assessment of potential predictors of calretinin and mesothelin to improve the diagnostic performance to detect malignant mesothelioma: results from a population-based cohort study.BMJ Open. 2017 Oct 11;7(10):e017104. doi: 10.1136/bmjopen-2017-017104.
33 Sublaminar organization of the human subplate: developmental changes in the distribution of neurons, glia, growing axons and extracellular matrix.J Anat. 2019 Sep;235(3):481-506. doi: 10.1111/joa.12920. Epub 2018 Dec 13.
34 The calcium-binding protein calretinin-22k, an alternative splicing product of the calretinin gene is expressed in several colon adeno carcinoma cell lines.Cell Calcium. 1996 Jul;20(1):63-72. doi: 10.1016/s0143-4160(96)90051-2.
35 Biomarkers in the diagnosis of pleural diseases: a 2018 update.Ther Adv Respir Dis. 2018 Jan-Dec;12:1753466618808660. doi: 10.1177/1753466618808660.
36 Long-term effects of autoimmune CNS inflammation on adult hippocampal neurogenesis.J Neurosci Res. 2017 Jul;95(7):1446-1458. doi: 10.1002/jnr.23982. Epub 2016 Oct 26.
37 Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
38 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
39 RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
40 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
41 Comparison of the global gene expression profiles produced by methylparaben, n-butylparaben and 17beta-oestradiol in MCF7 human breast cancer cells. J Appl Toxicol. 2007 Jan-Feb;27(1):67-77. doi: 10.1002/jat.1200.
42 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
43 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
44 Pharmacogenomic identification of novel determinants of response to chemotherapy in colon cancer. Cancer Res. 2006 Mar 1;66(5):2765-77.
45 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
46 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
47 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
48 Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
49 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
50 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
51 Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.
52 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
53 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.