Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSTC4YY)

• DOT Name: Proteasome activator complex subunit 3 (PSME3)
• Synonyms: 11S regulator complex subunit gamma; REG-gamma; Activator of multicatalytic protease subunit 3; Ki nuclear autoantigen; Proteasome activator 28 subunit gamma; PA28g; PA28gamma
• Gene Name: PSME3
• Related Disease:
  Gastric cancer
  Poorly differentiated thyroid gland carcinoma
  Stomach cancer
  Thyroid cancer
  Thyroid gland papillary carcinoma
  Thyroid tumor
  Arteriosclerosis
  Ataxia-telangiectasia
  Atherosclerosis
  Breast cancer
  Breast carcinoma
  Clear cell renal carcinoma
  Cognitive impairment
  Colitis
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Endometrial cancer
  Endometrial carcinoma
  Fatty liver disease
  Hepatitis B virus infection
  Hepatitis C virus infection
  Hepatocellular carcinoma
  HIV infectious disease
  Huntington disease
  Lung cancer
  Lung carcinoma
  Lupus
  Non-small-cell lung cancer
  Oral cancer
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Staphylococcus aureus infection
  Systemic lupus erythematosus
  Thyroid gland carcinoma
  Thyroid gland undifferentiated (anaplastic) carcinoma
  Autoimmune disease
  Lupus nephritis
  Plasma cell myeloma
  Advanced cancer
  Kennedy disease
  Melanoma
  Nervous system inflammation
  Pancreatic cancer
  Squamous cell carcinoma
• UniProt ID: PSME3_HUMAN
• PDB ID: 7YQC; 7YQD
• Pfam ID: PF02251 ; PF02252
• Sequence:
  MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHS
  DMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIE
  KVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQIS
  RYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIE
  KIKRPRSSNAETLY
• Function: Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a doughnut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. Facilitates the MDM2-p53/TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of p53/TP53, limiting its accumulation and resulting in inhibited apoptosis after DNA damage. May also be involved in cell cycle regulation. Mediates CCAR2 and CHEK2-dependent SIRT1 inhibition.
• KEGG Pathway:
  Proteasome (hsa03050)
  Antigen processing and presentation (hsa04612)
  Hepatitis C (hsa05160)
• Reactome Pathway:
  Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha (R-HSA-1234176)
  ER-Phagosome pathway (R-HSA-1236974)
  Cross-presentation of soluble exogenous antigens (endosomes) (R-HSA-1236978)
  Autodegradation of Cdh1 by Cdh1 (R-HSA-174084)
  SCF-beta-TrCP mediated degradation of Emi1 (R-HSA-174113)
  APC/C (R-HSA-174154)
  APC/C (R-HSA-174178)
  Cdc20 (R-HSA-174184)
  Vpu mediated degradation of CD4 (R-HSA-180534)
  Vif-mediated degradation of APOBEC3G (R-HSA-180585)
  SCF(Skp2)-mediated degradation of p27/p21 (R-HSA-187577)
  Degradation of beta-catenin by the destruction complex (R-HSA-195253)
  Downstream TCR signaling (R-HSA-202424)
  Regulation of activated PAK-2p34 by proteasome mediated degradation (R-HSA-211733)
  Separation of Sister Chromatids (R-HSA-2467813)
  FCERI mediated NF-kB activation (R-HSA-2871837)
  Autodegradation of the E3 ubiquitin ligase COP1 (R-HSA-349425)
  Regulation of ornithine decarboxylase (ODC) (R-HSA-350562)
  ABC-family proteins mediated transport (R-HSA-382556)
  AUF1 (hnRNP D0) binds and destabilizes mRNA (R-HSA-450408)
  Asymmetric localization of PCP proteins (R-HSA-4608870)
  Degradation of AXIN (R-HSA-4641257)
  Degradation of DVL (R-HSA-4641258)
  Hedgehog ligand biogenesis (R-HSA-5358346)
  Hh mutants are degraded by ERAD (R-HSA-5362768)
  Dectin-1 mediated noncanonical NF-kB signaling (R-HSA-5607761)
  CLEC7A (Dectin-1) signaling (R-HSA-5607764)
  Degradation of GLI1 by the proteasome (R-HSA-5610780)
  Degradation of GLI2 by the proteasome (R-HSA-5610783)
  GLI3 is processed to GLI3R by the proteasome (R-HSA-5610785)
  Hedgehog 'on' state (R-HSA-5632684)
  Regulation of RAS by GAPs (R-HSA-5658442)
  TNFR2 non-canonical NF-kB pathway (R-HSA-5668541)
  NIK-->noncanonical NF-kB signaling (R-HSA-5676590)
  Defective CFTR causes cystic fibrosis (R-HSA-5678895)
  MAPK6/MAPK4 signaling (R-HSA-5687128)
  UCH proteinases (R-HSA-5689603)
  Ub-specific processing proteases (R-HSA-5689880)
  Assembly of the pre-replicative complex (R-HSA-68867)
  Orc1 removal from chromatin (R-HSA-68949)
  CDK-mediated phosphorylation and removal of Cdc6 (R-HSA-69017)
  G2/M Checkpoints (R-HSA-69481)
  Ubiquitin Mediated Degradation of Phosphorylated Cdc25A (R-HSA-69601)
  Ubiquitin-dependent degradation of Cyclin D (R-HSA-75815)
  The role of GTSE1 in G2/M progression after G2 checkpoint (R-HSA-8852276)
  FBXL7 down-regulates AURKA during mitotic entry and in early mitosis (R-HSA-8854050)
  RUNX1 regulates transcription of genes involved in differentiation of HSCs (R-HSA-8939236)
  Regulation of RUNX2 expression and activity (R-HSA-8939902)
  Regulation of RUNX3 expression and activity (R-HSA-8941858)
  Regulation of PTEN stability and activity (R-HSA-8948751)
  Neddylation (R-HSA-8951664)
  Regulation of expression of SLITs and ROBOs (R-HSA-9010553)
  Interleukin-1 signaling (R-HSA-9020702)
  Negative regulation of NOTCH4 signaling (R-HSA-9604323)
  KEAP1-NFE2L2 pathway (R-HSA-9755511)
  GSK3B and BTRC (R-HSA-9762114)
  Somitogenesis (R-HSA-9824272)
  Antigen processing (R-HSA-983168)
  Activation of NF-kappaB in B cells (R-HSA-1169091)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric cancer	DISXGOUK	Definitive	Altered Expression	[1]
Poorly differentiated thyroid gland carcinoma	DISPBT1J	Definitive	Altered Expression	[2]
Stomach cancer	DISKIJSX	Definitive	Altered Expression	[1]
Thyroid cancer	DIS3VLDH	Definitive	Biomarker	[3]
Thyroid gland papillary carcinoma	DIS48YMM	Definitive	Biomarker	[4]
Thyroid tumor	DISLVKMD	Definitive	Biomarker	[3]
Arteriosclerosis	DISK5QGC	Strong	Altered Expression	[5]
Ataxia-telangiectasia	DISP3EVR	Strong	Genetic Variation	[6]
Atherosclerosis	DISMN9J3	Strong	Altered Expression	[5]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[8]
Cognitive impairment	DISH2ERD	Strong	Altered Expression	[9]
Colitis	DISAF7DD	Strong	Biomarker	[10]
Colon cancer	DISVC52G	Strong	Altered Expression	[11]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[10]
Endometrial cancer	DISW0LMR	Strong	Genetic Variation	[12]
Endometrial carcinoma	DISXR5CY	Strong	Genetic Variation	[12]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[13]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[14]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[16]
HIV infectious disease	DISO97HC	Strong	Biomarker	[17]
Huntington disease	DISQPLA4	Strong	Biomarker	[18]
Lung cancer	DISCM4YA	Strong	Biomarker	[19]
Lung carcinoma	DISTR26C	Strong	Biomarker	[19]
Lupus	DISOKJWA	Strong	Biomarker	[20]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[21]
Oral cancer	DISLD42D	Strong	Biomarker	[22]
Prostate cancer	DISF190Y	Strong	Biomarker	[23]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[23]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[8]
Staphylococcus aureus infection	DISK6PTH	Strong	Biomarker	[24]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[20]
Thyroid gland carcinoma	DISMNGZ0	Strong	Biomarker	[3]
Thyroid gland undifferentiated (anaplastic) carcinoma	DISYBB1W	Strong	Biomarker	[25]
Autoimmune disease	DISORMTM	moderate	Biomarker	[26]
Lupus nephritis	DISCVGPZ	moderate	Altered Expression	[26]
Plasma cell myeloma	DIS0DFZ0	moderate	Biomarker	[27]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[22]
Kennedy disease	DISXZVM1	Limited	Altered Expression	[28]
Melanoma	DIS1RRCY	Limited	Biomarker	[29]
Nervous system inflammation	DISB3X5A	Limited	Biomarker	[30]
Pancreatic cancer	DISJC981	Limited	Biomarker	[31]
Squamous cell carcinoma	DISQVIFL	Limited	Biomarker	[32]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Proteasome activator complex subunit 3 (PSME3).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Proteasome activator complex subunit 3 (PSME3).	[44]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Proteasome activator complex subunit 3 (PSME3).	[34]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Proteasome activator complex subunit 3 (PSME3).	[35]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Proteasome activator complex subunit 3 (PSME3).	[36]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Proteasome activator complex subunit 3 (PSME3).	[37]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Proteasome activator complex subunit 3 (PSME3).	[38]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Proteasome activator complex subunit 3 (PSME3).	[39]
Marinol	DM70IK5	Approved	Marinol increases the expression of Proteasome activator complex subunit 3 (PSME3).	[40]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Proteasome activator complex subunit 3 (PSME3).	[41]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Proteasome activator complex subunit 3 (PSME3).	[42]
Glucosamine	DM4ZLFD	Approved	Glucosamine decreases the expression of Proteasome activator complex subunit 3 (PSME3).	[43]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Proteasome activator complex subunit 3 (PSME3).	[34]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Proteasome activator complex subunit 3 (PSME3).	[45]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Proteasome activator complex subunit 3 (PSME3).	[46]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Proteasome activator complex subunit 3 (PSME3).	[47]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone decreases the expression of Proteasome activator complex subunit 3 (PSME3).	[48]
(E)-4-(3,5-dimethoxystyryl)phenol	DMYXI2V	Investigative	(E)-4-(3,5-dimethoxystyryl)phenol decreases the expression of Proteasome activator complex subunit 3 (PSME3).	[49]

References

• [1] Downregulation of CircRNA CDR1as specifically triggered low-dose Diosbulbin-B induced gastric cancer cell death by regulating miR-7-5p/REG axis.Biomed Pharmacother. 2019 Dec;120:109462. doi: 10.1016/j.biopha.2019.109462. Epub 2019 Sep 19.
• [2] REG is a strong candidate for the regulation of cell cycle, proliferation and the invasion by poorly differentiated thyroid carcinoma cells.Braz J Med Biol Res. 2012 May;45(5):459-65. doi: 10.1590/s0100-879x2012007500035. Epub 2012 Mar 15.
• [3] REG potentiates TGF-/Smad signal dependent epithelial-mesenchymal transition in thyroid cancer cells.Cell Signal. 2019 Dec;64:109412. doi: 10.1016/j.cellsig.2019.109412. Epub 2019 Sep 3.
• [4] REG Is Associated with Lymph Node Metastasis and T-Stage in Papillary Thyroid Carcinoma.Med Sci Monit. 2018 Mar 6;24:1373-1378. doi: 10.12659/msm.905664.
• [5] Expression of REG in atherosclerotic plaques and promotes endothelial cells apoptosis via the cyclophilin A pathway indicates functional implications in atherogenesis.Cell Cycle. 2019 Sep;18(17):2083-2098. doi: 10.1080/15384101.2019.1639304. Epub 2019 Jul 7.
• [6] Human T-lymphotropic virus type 1 p30 interacts with REGgamma and modulates ATM (ataxia telangiectasia mutated) to promote cell survival.J Biol Chem. 2011 Mar 4;286(9):7661-8. doi: 10.1074/jbc.M110.176354. Epub 2011 Jan 7.
• [7] PSME3 induces epithelial-mesenchymal transition with inducing the expression of CSC markers and immunosuppression in breast cancer.Exp Cell Res. 2017 Sep 15;358(2):87-93. doi: 10.1016/j.yexcr.2017.05.017. Epub 2017 May 19.
• [8] REG deficiency suppresses tumor progression via stabilizing CK1 in renal cell carcinoma.Cell Death Dis. 2018 May 24;9(6):627. doi: 10.1038/s41419-018-0646-2.
• [9] Tau inhibits PKA by nuclear proteasome-dependent PKAR2 elevation with suppressed CREB/GluA1 phosphorylation.Aging Cell. 2020 Jan;19(1):e13055. doi: 10.1111/acel.13055. Epub 2019 Oct 31.
• [10] REG Controls Hippo Signaling and Reciprocal NF-B-YAP Regulation to Promote Colon Cancer.Clin Cancer Res. 2018 Apr 15;24(8):2015-2025. doi: 10.1158/1078-0432.CCR-17-2986. Epub 2018 Feb 6.
• [11] Downregulated miR-585-3p promotes cell growth and proliferation in colon cancer by upregulating PSME3.Onco Targets Ther. 2019 Aug 14;12:6525-6534. doi: 10.2147/OTT.S203175. eCollection 2019.
• [12] Mutant p53 (p53-R248Q) functions as an oncogene in promoting endometrial cancer by up-regulating REG.Cancer Lett. 2015 May 1;360(2):269-79. doi: 10.1016/j.canlet.2015.02.028. Epub 2015 Feb 16.
• [13] The REG proteasome regulates hepatic lipid metabolism through inhibition of autophagy.Cell Metab. 2013 Sep 3;18(3):380-91. doi: 10.1016/j.cmet.2013.08.012.
• [14] HBx natural variants containing Ser-101 instead of Pro-101 evade ubiquitin-dependent proteasomal degradation by activating proteasomal activator 28 gamma expression.J Gen Virol. 2019 Nov;100(11):1554-1566. doi: 10.1099/jgv.0.001337.
• [15] N-terminal HCV core protein fragment decreases 20S proteasome activity in the presence of PA28.Biochem Biophys Res Commun. 2019 Feb 5;509(2):590-595. doi: 10.1016/j.bbrc.2018.12.167. Epub 2018 Dec 31.
• [16] Hepatitis B virus X protein activates proteasomal activator 28 gamma expression via upregulation of p53 levels to stimulate virus replication.J Gen Virol. 2018 May;99(5):655-666. doi: 10.1099/jgv.0.001054. Epub 2018 Apr 3.
• [17] Host cell gene expression during human immunodeficiency virus type 1 latency and reactivation and effects of targeting genes that are differentially expressed in viral latency.J Virol. 2004 Sep;78(17):9458-73. doi: 10.1128/JVI.78.17.9458-9473.2004.
• [18] Gene therapy by proteasome activator, PA28, improves motor coordination and proteasome function in Huntington's disease YAC128 mice.Neuroscience. 2016 Jun 2;324:20-8. doi: 10.1016/j.neuroscience.2016.02.054. Epub 2016 Mar 2.
• [19] Proteasome-dependent degradation of Smad7 is critical for lung cancer metastasis.Cell Death Differ. 2020 Jun;27(6):1795-1806. doi: 10.1038/s41418-019-0459-6. Epub 2019 Nov 26.
• [20] Relationships between autoantibody responses to deletion mutants of Ki antigen and clinical manifestations of lupus.J Rheumatol. 2003 Jun;30(6):1208-14.
• [21] PA28gamma emerges as a novel functional target of tumour suppressor microRNA-7 in non-small-cell lung cancer.Br J Cancer. 2014 Jan 21;110(2):353-62. doi: 10.1038/bjc.2013.728. Epub 2013 Nov 26.
• [22] The significance of PA28 and U2AF1 in oral mucosal carcinogenesis.Oral Dis. 2020 Jan;26(1):53-61. doi: 10.1111/odi.13213. Epub 2019 Oct 29.
• [23] Knockdown of REG inhibits proliferation by inducing apoptosis and cell cycle arrest in prostate cancer.Am J Transl Res. 2017 Aug 15;9(8):3787-3795. eCollection 2017.
• [24] Dusp3 and Psme3 are associated with murine susceptibility to Staphylococcus aureus infection and human sepsis.PLoS Pathog. 2014 Jun 5;10(6):e1004149. doi: 10.1371/journal.ppat.1004149. eCollection 2014 Jun.
• [25] REG ablation impedes dedifferentiation of anaplastic thyroid carcinoma and accentuates radio-therapeutic response by regulating the Smad7-TGF- pathway.Cell Death Differ. 2020 Feb;27(2):497-508. doi: 10.1038/s41418-019-0367-9. Epub 2019 Jun 26.
• [26] The proteasome activator REG counteracts immunoproteasome expression and autoimmunity.J Autoimmun. 2019 Sep;103:102282. doi: 10.1016/j.jaut.2019.05.010. Epub 2019 Jun 4.
• [27] Knockdown of REG inhibits the proliferation and migration and promotes the apoptosis of multiple myeloma cells by downregulating NF-B signal pathway.Hematology. 2018 Jun;23(5):277-283. doi: 10.1080/10245332.2017.1385194. Epub 2017 Oct 11.
• [28] The 11S Proteasomal Activator REG Impacts Polyglutamine-Expanded Androgen Receptor Aggregation and Motor Neuron Viability through Distinct Mechanisms.Front Mol Neurosci. 2017 May 24;10:159. doi: 10.3389/fnmol.2017.00159. eCollection 2017.
• [29] REG accelerates melanoma formation by regulating Wnt/-catenin signalling pathway.Exp Dermatol. 2017 Nov;26(11):1118-1124. doi: 10.1111/exd.13394. Epub 2017 Aug 30.
• [30] REG controls Th17 cell differentiation and autoimmune inflammation by regulating dendritic cells.Cell Mol Immunol. 2020 Nov;17(11):1136-1147. doi: 10.1038/s41423-019-0287-0. Epub 2019 Sep 11.
• [31] PSME3 Promotes TGFB1 Secretion by Pancreatic Cancer Cells to Induce Pancreatic Stellate Cell Proliferation.J Cancer. 2019 May 16;10(9):2128-2138. doi: 10.7150/jca.30235. eCollection 2019.
• [32] PA28 acts as a dual regulator of IL-6 and CCL2 and contributes to tumor angiogenesis in oral squamous cell carcinoma.Cancer Lett. 2018 Aug 1;428:192-200. doi: 10.1016/j.canlet.2018.04.024. Epub 2018 Apr 24.
• [33] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [34] Gene expression changes associated with cytotoxicity identified using cDNA arrays. Funct Integr Genomics. 2000 Sep;1(2):114-26.
• [35] Extremely low copper concentrations affect gene expression profiles of human prostate epithelial cell lines. Chem Biol Interact. 2010 Oct 6;188(1):214-9.
• [36] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [37] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [38] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [39] Proteomic and functional analyses reveal a dual molecular mechanism underlying arsenic-induced apoptosis in human multiple myeloma cells. J Proteome Res. 2009 Jun;8(6):3006-19.
• [40] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [41] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [42] Heavy metals chromium and neodymium reduced phosphorylation level of heat shock protein 27 in human keratinocytes. Toxicol In Vitro. 2010 Jun;24(4):1098-104. doi: 10.1016/j.tiv.2010.03.011. Epub 2010 Mar 21.
• [43] Glucosamine induces cell death via proteasome inhibition in human ALVA41 prostate cancer cell. Exp Mol Med. 2011 Sep 30;43(9):487-93. doi: 10.3858/emm.2011.43.9.055.
• [44] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [45] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [46] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [47] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [48] Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.
• [49] Proteomic identification of pterostilbene-mediated anticancer activities in HepG2 cells. Chem Res Toxicol. 2014 Jul 21;27(7):1243-52. doi: 10.1021/tx5001392. Epub 2014 Jul 1.