Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTJC0D6)

DOT Name Armadillo-like helical domain containing protein 1 (ARMH1)
Synonyms p40
Gene Name ARMH1
Related Disease
Colorectal carcinoma ( )
Ductal breast carcinoma in situ ( )
Abdominal aortic aneurysm ( )
Adenoma ( )
Advanced cancer ( )
Alzheimer disease ( )
Autoimmune disease ( )
Breast cancer ( )
Carcinoma ( )
Dementia ( )
Ewing sarcoma ( )
Hepatitis C virus infection ( )
Hepatocellular carcinoma ( )
HIV infectious disease ( )
Immunodeficiency ( )
Inflammatory bowel disease ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Multiple sclerosis ( )
Mycobacterium infection ( )
Nervous system inflammation ( )
Non-hodgkin lymphoma ( )
Non-small-cell lung cancer ( )
Osteoarthritis ( )
Prostate cancer ( )
Prostate carcinoma ( )
Psoriasis ( )
Pulmonary disease ( )
Rheumatoid arthritis ( )
Systemic lupus erythematosus ( )
Tuberculosis ( )
Ulcerative colitis ( )
Ankylosing spondylitis ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Breast carcinoma ( )
Small-cell lung cancer ( )
Type-1/2 diabetes ( )
Malaria ( )
Arthritis ( )
Asthma ( )
Atopic dermatitis ( )
Colitis ( )
Neoplasm ( )
Type-1 diabetes ( )
UniProt ID
ARMD1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF17741
Sequence
MTSIKEQAAISRLLSFLQEWDNAGKVARSHILDKFIETNQGKTAPELEQEFSQGASLFLV
RLTTSLRITYMTDSCLEKLLRSIGIFLSAVSSNRYLIEFLEVGGVLTLLEILGLEKIKEE
AKKESVKLLQVIANSGRTYKELICESYGVRSIAEFLAKSKSEETQEEVQVLLDSLVHGNP
KYQNQVYKGLIALLPCESPKAQQLSLQTLRTAQPIIGTTHPSIVDCVLKVLGTMHLEVQY
EAIELIKDLVGYDVRQALLKGLVALLIPSVKEISKLQAKILSDPSVLQLTPSLPMFLQQA
AAAKAIGVLARNDMSIAEELLYLRVVRGLMAAMGNTDHSNSQRLASLTLECFVQMFPLVA
EHVRKCMGEELYQLFLSNAEDLYMKIDSIQADILAANTVNVTKALCLHGSSYSMNTLYGS
RDSAQMAYLTHFEEDVESKE

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Colorectal carcinoma DIS5PYL0 Definitive Biomarker [1]
Ductal breast carcinoma in situ DISLCJY7 Definitive Altered Expression [2]
Abdominal aortic aneurysm DISD06OF Strong Biomarker [3]
Adenoma DIS78ZEV Strong Altered Expression [4]
Advanced cancer DISAT1Z9 Strong Biomarker [5]
Alzheimer disease DISF8S70 Strong Biomarker [6]
Autoimmune disease DISORMTM Strong Biomarker [7]
Breast cancer DIS7DPX1 Strong Altered Expression [8]
Carcinoma DISH9F1N Strong Genetic Variation [9]
Dementia DISXL1WY Strong Biomarker [6]
Ewing sarcoma DISQYLV3 Strong Altered Expression [10]
Hepatitis C virus infection DISQ0M8R Strong Biomarker [11]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [12]
HIV infectious disease DISO97HC Strong Genetic Variation [13]
Immunodeficiency DIS093I0 Strong Altered Expression [14]
Inflammatory bowel disease DISGN23E Strong Biomarker [15]
Lung adenocarcinoma DISD51WR Strong Biomarker [16]
Lung cancer DISCM4YA Strong Biomarker [17]
Lung carcinoma DISTR26C Strong Biomarker [18]
Multiple sclerosis DISB2WZI Strong Biomarker [19]
Mycobacterium infection DISNSMUD Strong Genetic Variation [20]
Nervous system inflammation DISB3X5A Strong Biomarker [21]
Non-hodgkin lymphoma DISS2Y8A Strong Altered Expression [22]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [23]
Osteoarthritis DIS05URM Strong Altered Expression [24]
Prostate cancer DISF190Y Strong Altered Expression [5]
Prostate carcinoma DISMJPLE Strong Altered Expression [5]
Psoriasis DIS59VMN Strong Biomarker [25]
Pulmonary disease DIS6060I Strong Altered Expression [26]
Rheumatoid arthritis DISTSB4J Strong Altered Expression [24]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [7]
Tuberculosis DIS2YIMD Strong Altered Expression [27]
Ulcerative colitis DIS8K27O Strong Biomarker [28]
Ankylosing spondylitis DISRC6IR moderate Biomarker [24]
Arteriosclerosis DISK5QGC moderate Genetic Variation [29]
Atherosclerosis DISMN9J3 moderate Genetic Variation [29]
Breast carcinoma DIS2UE88 moderate Altered Expression [2]
Small-cell lung cancer DISK3LZD moderate Altered Expression [30]
Type-1/2 diabetes DISIUHAP moderate Genetic Variation [29]
Malaria DISQ9Y50 Disputed Biomarker [31]
Arthritis DIST1YEL Limited Biomarker [32]
Asthma DISW9QNS Limited Altered Expression [33]
Atopic dermatitis DISTCP41 Limited Biomarker [34]
Colitis DISAF7DD Limited Altered Expression [35]
Neoplasm DISZKGEW Limited Biomarker [36]
Type-1 diabetes DIS7HLUB Limited Altered Expression [37]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Armadillo-like helical domain containing protein 1 (ARMH1). [38]
Testosterone DM7HUNW Approved Testosterone increases the expression of Armadillo-like helical domain containing protein 1 (ARMH1). [39]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Armadillo-like helical domain containing protein 1 (ARMH1). [41]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Armadillo-like helical domain containing protein 1 (ARMH1). [42]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Armadillo-like helical domain containing protein 1 (ARMH1). [40]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Armadillo-like helical domain containing protein 1 (ARMH1). [43]
------------------------------------------------------------------------------------

References

1 Role of anthocyanin-enriched purple-fleshed sweet potato p40 in colorectal cancer prevention.Mol Nutr Food Res. 2013 Nov;57(11):1908-17. doi: 10.1002/mnfr.201300040. Epub 2013 Jun 19.
2 Evaluation of p40 as a Myoepithelial Marker in Different Breast Lesions.Pathobiology. 2015 Sep;82(3-4):166-71. doi: 10.1159/000375127. Epub 2015 Aug 31.
3 Interleukin-12 and -23 blockade mitigates elastase-induced abdominal aortic aneurysm.Sci Rep. 2019 Jul 18;9(1):10447. doi: 10.1038/s41598-019-46909-y.
4 Investigation of IL-23 (p19, p40) and IL-23R identifies nuclear expression of IL-23 p19 as a favorable prognostic factor in colorectal cancer: a retrospective multicenter study of 675 patients.Oncotarget. 2014 Jul 15;5(13):4671-82. doi: 10.18632/oncotarget.2069.
5 Selective neutralization of IL-12 p40 monomer induces death in prostate cancer cells via IL-12-IFN-.Proc Natl Acad Sci U S A. 2017 Oct 24;114(43):11482-11487. doi: 10.1073/pnas.1705536114. Epub 2017 Oct 9.
6 Reduced cerebrospinal fluid concentration of interleukin-12/23 subunit p40 in patients with cognitive impairment.PLoS One. 2017 May 2;12(5):e0176760. doi: 10.1371/journal.pone.0176760. eCollection 2017.
7 High Prevalence and Disease Correlation of Autoantibodies Against p40 Encoded by Long Interspersed Nuclear Elements in Systemic Lupus Erythematosus.Arthritis Rheumatol. 2020 Jan;72(1):89-99. doi: 10.1002/art.41054.
8 Comparative expression of the LINE-1 p40 protein in human breast carcinomas and normal breast tissues.Oncol Res. 1996;8(6):239-47.
9 RETRACTED ARTICLE: Cervical adenosquamous carcinoma: detailed analysis of morphology, immunohistochemical profile, and clinical outcomes in 59 cases.Mod Pathol. 2019 Feb;32(2):269-279. doi: 10.1038/s41379-018-0123-6. Epub 2018 Sep 26.
10 Adamantinoma-like Ewing Sarcoma of the Salivary Glands: A Newly Recognized Mimicker of Basaloid Salivary Carcinomas.Am J Surg Pathol. 2019 Feb;43(2):187-194. doi: 10.1097/PAS.0000000000001171.
11 Impaired allostimulatory capacity of peripheral blood dendritic cells recovered from hepatitis C virus-infected individuals.J Immunol. 1999 May 1;162(9):5584-91.
12 PTK2 and EIF3S3 genes may be amplification targets at 8q23-q24 and are associated with large hepatocellular carcinomas.Hepatology. 2003 Nov;38(5):1242-9. doi: 10.1053/jhep.2003.50457.
13 Disruption of MAP kinase activation and nuclear factor binding to the IL-12 p40 promoter in HIV-infected myeloid cells.Clin Exp Immunol. 2004 Aug;137(2):329-40. doi: 10.1111/j.1365-2249.2004.02513.x.
14 Molecular analysis of decreased interleukin-12 production in persons infected with human immunodeficiency virus.J Infect Dis. 1996 Jul;174(1):46-53. doi: 10.1093/infdis/174.1.46.
15 Allergic and Immunologic Perspectives of Inflammatory Bowel Disease.Clin Rev Allergy Immunol. 2019 Oct;57(2):179-193. doi: 10.1007/s12016-018-8690-3.
16 CDX-2 Expression in Primary Lung Adenocarcinoma.Appl Immunohistochem Mol Morphol. 2016 Jan;24(1):16-9. doi: 10.1097/PAI.0000000000000250.
17 Mucin staining is of limited value in addition to basic immunohistochemical analyses in the diagnostics of non-small cell lung cancer.Sci Rep. 2019 Feb 4;9(1):1319. doi: 10.1038/s41598-018-37722-0.
18 Biomarkers in the diagnosis of pleural diseases: a 2018 update.Ther Adv Respir Dis. 2018 Jan-Dec;12:1753466618808660. doi: 10.1177/1753466618808660.
19 Meta-analysis of the IL23R and IL12B polymorphisms in multiple sclerosis.Int J Neurosci. 2016;126(3):205-12. doi: 10.3109/00207454.2015.1007508. Epub 2015 Jun 16.
20 Chronic Disseminated Salmonellosis in a Patient With Interleukin-12p40 Deficiency.Pediatr Infect Dis J. 2018 Jan;37(1):90-93. doi: 10.1097/INF.0000000000001701.
21 Silencing c-Rel in macrophages dampens Th1 and Th17 immune responses and alleviates experimental autoimmune encephalomyelitis in mice.Immunol Cell Biol. 2017 Aug;95(7):593-600. doi: 10.1038/icb.2017.11. Epub 2017 Feb 16.
22 Th1/Th2 cytokine expression and its relationship with tumor growth in B cell non-Hodgkin's lymphoma (NHL).Leuk Lymphoma. 2002 Jun;43(6):1313-21. doi: 10.1080/10428190290026385.
23 Non-small cell lung carcinoma with diffuse coexpression of thyroid transcription factor-1 and Np63/p40.Hum Pathol. 2018 Aug;78:177-181. doi: 10.1016/j.humpath.2018.01.023. Epub 2018 Feb 2.
24 IL-17A induces osteoblast differentiation by activating JAK2/STAT3 in ankylosing spondylitis.Arthritis Res Ther. 2018 Jun 7;20(1):115. doi: 10.1186/s13075-018-1582-3.
25 Anti-IL-12/IL-23p40 antibody ameliorates dermatitis and skin barrier dysfunction in mice with imiquimod-induced psoriasis-like dermatitis.Eur J Pharmacol. 2018 Jun 5;828:26-30. doi: 10.1016/j.ejphar.2018.03.018. Epub 2018 Mar 12.
26 Interleukin 23/interleukin 17 axis activated by Mycobacterium avium complex (MAC) is attenuated in patients with MAC-lung disease.Tuberculosis (Edinb). 2018 May;110:7-14. doi: 10.1016/j.tube.2018.03.001. Epub 2018 Mar 3.
27 Mycobacterium tuberculosis PPE44 (Rv2770c) is involved in response to multiple stresses and promotes the macrophage expression of IL-12 p40 and IL-6 via the p38, ERK, and NF-B signaling axis.Int Immunopharmacol. 2017 Sep;50:319-329. doi: 10.1016/j.intimp.2017.06.028. Epub 2017 Jul 22.
28 Expert opinion on interleukin-12/23 and interleukin-23 antagonists as potential therapeutic options for the treatment of inflammatory bowel disease.Expert Opin Investig Drugs. 2019 May;28(5):473-479. doi: 10.1080/13543784.2019.1597053. Epub 2019 Mar 26.
29 Polymorphism of the 3'-untranslated region of interleukin-12 p40 gene is not associated with the presence or severity of coronary artery disease.Circ J. 2005 Jul;69(7):793-7. doi: 10.1253/circj.69.793.
30 P40 expression in small cell lung cancer: The presence of p40-positive cells does not always indicate squamous differentiation.Thorac Cancer. 2019 May;10(5):1188-1192. doi: 10.1111/1759-7714.13062. Epub 2019 Apr 7.
31 A replication study of the association between the IL12B promoter allele CTCTAA and susceptibility to cerebral malaria in Thai population.Malar J. 2009 Dec 11;8:290. doi: 10.1186/1475-2875-8-290.
32 Divergent effects of IL-12 and IL-23 on the production of IL-17 by human T cells.Eur J Immunol. 2006 Mar;36(3):661-70. doi: 10.1002/eji.200535239.
33 Associations of the IL12B promoter polymorphism in longitudinal data from asthmatic patients 7 to 42 years of age.J Allergy Clin Immunol. 2004 Mar;113(3):475-81. doi: 10.1016/j.jaci.2003.10.043.
34 Ustekinumab treatment in severe atopic dermatitis: Down-regulation of T-helper 2/22 expression.J Am Acad Dermatol. 2017 Jan;76(1):91-97.e3. doi: 10.1016/j.jaad.2016.07.047. Epub 2016 Oct 13.
35 Production of a Functional Factor, p40, by Lactobacillus rhamnosus GG Is Promoted by Intestinal Epithelial Cell-Secreted Extracellular Vesicles.Infect Immun. 2019 Jun 20;87(7):e00113-19. doi: 10.1128/IAI.00113-19. Print 2019 Jul.
36 American Registry of Pathology Expert Opinions: Evaluation of poorly differentiated malignant neoplasms on limited samples - Gastrointestinal mucosal biopsies.Ann Diagn Pathol. 2020 Feb;44:151419. doi: 10.1016/j.anndiagpath.2019.151419. Epub 2019 Nov 15.
37 Alleles of the IL12B 3'UTR associate with late onset of type 1 diabetes.Hum Immunol. 2004 Dec;65(12):1432-6. doi: 10.1016/j.humimm.2004.09.001.
38 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
39 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
40 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
41 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
42 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
43 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.