Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTLM5RU)

• DOT Name: TNF receptor-associated factor 1 (TRAF1)
• Synonyms: Epstein-Barr virus-induced protein 6
• Gene Name: TRAF1
• Related Disease:
  Classic Hodgkin lymphoma
  Neoplasm
  Adenocarcinoma
  Adult lymphoma
  Advanced cancer
  Arteriosclerosis
  Atherosclerosis
  Autoimmune disease
  B-cell neoplasm
  Carcinoma
  Cardiovascular disease
  Clear cell renal carcinoma
  Colon cancer
  Colonic neoplasm
  Epilepsy
  HIV infectious disease
  Inflammatory bowel disease
  leukaemia
  Leukemia
  Lung cancer
  Lung carcinoma
  Lymphoma
  Multiple sclerosis
  Non-small-cell lung cancer
  Osteoarthritis
  Pediatric lymphoma
  Pneumonia
  Prostate carcinoma
  Prostate neoplasm
  Pulmonary disease
  Renal cell carcinoma
  Small lymphocytic lymphoma
  Squamous cell carcinoma
  Colorectal carcinoma
  Coronary atherosclerosis
  Immune system disorder
  Myocardial ischemia
  Nasopharyngeal carcinoma
  Patent ductus arteriosus
  Stroke
  Arthritis
  Adult glioblastoma
  Breast cancer
  Breast carcinoma
  Glioblastoma multiforme
  Glioma
  Lymphoma, non-Hodgkin, familial
  Non-hodgkin lymphoma
  Prostate cancer
• UniProt ID: TRAF1_HUMAN
• PDB ID: 3M0D; 5E1T; 5H10
• Pfam ID: PF21355 ; PF16673
• Sequence:
  MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGE
  DLQSISPGSRLRTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
  GFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQH
  FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQ
  QTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK
  YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
  AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST
• Function: Adapter molecule that regulates the activation of NF-kappa-B and JNK. Plays a role in the regulation of cell survival and apoptosis. The heterotrimer formed by TRAF1 and TRAF2 is part of a E3 ubiquitin-protein ligase complex that promotes ubiquitination of target proteins, such as MAP3K14. The TRAF1/TRAF2 complex recruits the antiapoptotic E3 protein-ubiquitin ligases BIRC2 and BIRC3 to TNFRSF1B/TNFR2.
• KEGG Pathway:
  NF-kappa B sig.ling pathway (hsa04064)
  Apoptosis (hsa04210)
  TNF sig.ling pathway (hsa04668)
  Pathways in cancer (hsa05200)
  Transcriptio.l misregulation in cancer (hsa05202)
  Viral carcinogenesis (hsa05203)
  Small cell lung cancer (hsa05222)
• Reactome Pathway:
  TNFR1-induced NF-kappa-B signaling pathway (R-HSA-5357956)
  Regulation of TNFR1 signaling (R-HSA-5357905)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Classic Hodgkin lymphoma	DISV1LU6	Definitive	Altered Expression	[1]
Neoplasm	DISZKGEW	Definitive	Altered Expression	[2]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[3]
Adult lymphoma	DISK8IZR	Strong	Biomarker	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[6]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[6]
Autoimmune disease	DISORMTM	Strong	Genetic Variation	[7]
B-cell neoplasm	DISVY326	Strong	Biomarker	[8]
Carcinoma	DISH9F1N	Strong	Posttranslational Modification	[9]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[10]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[11]
Colon cancer	DISVC52G	Strong	Biomarker	[12]
Colonic neoplasm	DISSZ04P	Strong	Altered Expression	[12]
Epilepsy	DISBB28L	Strong	Biomarker	[13]
HIV infectious disease	DISO97HC	Strong	Biomarker	[14]
Inflammatory bowel disease	DISGN23E	Strong	Altered Expression	[15]
leukaemia	DISS7D1V	Strong	Biomarker	[16]
Leukemia	DISNAKFL	Strong	Biomarker	[16]
Lung cancer	DISCM4YA	Strong	Biomarker	[5]
Lung carcinoma	DISTR26C	Strong	Biomarker	[5]
Lymphoma	DISN6V4S	Strong	Biomarker	[4]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[17]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[18]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[19]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[4]
Pneumonia	DIS8EF3M	Strong	Biomarker	[3]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[8]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[20]
Pulmonary disease	DIS6060I	Strong	Biomarker	[3]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[11]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[21]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[2]
Colorectal carcinoma	DIS5PYL0	moderate	Posttranslational Modification	[9]
Coronary atherosclerosis	DISKNDYU	moderate	Biomarker	[22]
Immune system disorder	DISAEGPH	moderate	Genetic Variation	[23]
Myocardial ischemia	DISFTVXF	moderate	Biomarker	[22]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Altered Expression	[24]
Patent ductus arteriosus	DIS9P8YS	moderate	Biomarker	[25]
Stroke	DISX6UHX	moderate	Altered Expression	[26]
Arthritis	DIST1YEL	Disputed	Biomarker	[27]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[28]
Breast cancer	DIS7DPX1	Limited	Biomarker	[29]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[29]
Glioblastoma multiforme	DISK8246	Limited	Altered Expression	[28]
Glioma	DIS5RPEH	Limited	Altered Expression	[30]
Lymphoma, non-Hodgkin, familial	DISCXYIZ	Limited	Genetic Variation	[31]
Non-hodgkin lymphoma	DISS2Y8A	Limited	Genetic Variation	[31]
Prostate cancer	DISF190Y	Limited	Altered Expression	[8]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Bryostatin-1	DM1JOXY	Phase 2	TNF receptor-associated factor 1 (TRAF1) increases the Apoptosis ADR of Bryostatin-1.	[60]

28 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of TNF receptor-associated factor 1 (TRAF1).	[32]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of TNF receptor-associated factor 1 (TRAF1).	[33]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of TNF receptor-associated factor 1 (TRAF1).	[34]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of TNF receptor-associated factor 1 (TRAF1).	[35]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of TNF receptor-associated factor 1 (TRAF1).	[36]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of TNF receptor-associated factor 1 (TRAF1).	[37]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of TNF receptor-associated factor 1 (TRAF1).	[38]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of TNF receptor-associated factor 1 (TRAF1).	[39]
Folic acid	DMEMBJC	Approved	Folic acid affects the expression of TNF receptor-associated factor 1 (TRAF1).	[40]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of TNF receptor-associated factor 1 (TRAF1).	[41]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of TNF receptor-associated factor 1 (TRAF1).	[42]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of TNF receptor-associated factor 1 (TRAF1).	[43]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of TNF receptor-associated factor 1 (TRAF1).	[44]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of TNF receptor-associated factor 1 (TRAF1).	[45]
Gemcitabine	DMSE3I7	Approved	Gemcitabine affects the expression of TNF receptor-associated factor 1 (TRAF1).	[46]
Liothyronine	DM6IR3P	Approved	Liothyronine increases the expression of TNF receptor-associated factor 1 (TRAF1).	[47]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of TNF receptor-associated factor 1 (TRAF1).	[48]
Berberine	DMC5Q8X	Phase 4	Berberine increases the expression of TNF receptor-associated factor 1 (TRAF1).	[49]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of TNF receptor-associated factor 1 (TRAF1).	[50]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of TNF receptor-associated factor 1 (TRAF1).	[51]
Fenretinide	DMRD5SP	Phase 3	Fenretinide decreases the expression of TNF receptor-associated factor 1 (TRAF1).	[52]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of TNF receptor-associated factor 1 (TRAF1).	[54]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of TNF receptor-associated factor 1 (TRAF1).	[55]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 decreases the expression of TNF receptor-associated factor 1 (TRAF1).	[56]
Dioscin	DM5H2W9	Preclinical	Dioscin increases the expression of TNF receptor-associated factor 1 (TRAF1).	[57]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of TNF receptor-associated factor 1 (TRAF1).	[41]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of TNF receptor-associated factor 1 (TRAF1).	[58]
RHEIN	DMS6IJ0	Investigative	RHEIN increases the expression of TNF receptor-associated factor 1 (TRAF1).	[59]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of TNF receptor-associated factor 1 (TRAF1).	[53]

References

• [1] TNF receptor-associated factor 1 is a positive regulator of the NF-kappaB alternative pathway.Mol Immunol. 2009 Oct;46(16):3278-82. doi: 10.1016/j.molimm.2009.07.029. Epub 2009 Aug 20.
• [2] TRAF1 Is Critical for DMBA/Solar UVR-Induced Skin Carcinogenesis.J Invest Dermatol. 2017 Jun;137(6):1322-1332. doi: 10.1016/j.jid.2016.12.026. Epub 2017 Jan 25.
• [3] Tumor necrosis factor-alpha-induced lung cell expression of antiapoptotic genes TRAF1 and cIAP2.Am J Respir Cell Mol Biol. 2000 Feb;22(2):150-6. doi: 10.1165/ajrcmb.22.2.3783.
• [4] The Upregulation of TRAF1 Induced by Helicobacter pylori Plays an Antiapoptotic Effect on the Infected Cells.Helicobacter. 2016 Dec;21(6):554-564. doi: 10.1111/hel.12311. Epub 2016 Apr 6.
• [5] TRAF1 Is Critical for Regulating the BRAF/MEK/ERK Pathway in Non-Small Cell Lung Carcinogenesis.Cancer Res. 2018 Jul 15;78(14):3982-3994. doi: 10.1158/0008-5472.CAN-18-0429. Epub 2018 May 10.
• [6] Tumor necrosis factor receptor-associated factor 1 (TRAF1) deficiency attenuates atherosclerosis in mice by impairing monocyte recruitment to the vessel wall.Circulation. 2010 May 11;121(18):2033-44. doi: 10.1161/CIRCULATIONAHA.109.895037. Epub 2010 Apr 26.
• [7] Tumor necrosis factor receptor-associated factor 1 (TRAF1) polymorphisms and susceptibility to autoimmune thyroid disease.Autoimmunity. 2016;49(2):84-9. doi: 10.3109/08916934.2015.1124423. Epub 2015 Dec 24.
• [8] MicroRNA-1180 is associated with growth and apoptosis in prostate cancer via TNF receptor associated factor 1 expression regulation and nuclear factor-B signaling pathway activation.Oncol Lett. 2018 Apr;15(4):4775-4780. doi: 10.3892/ol.2018.7914. Epub 2018 Jan 31.
• [9] miR-181a-2* expression is different amongst carcinomas from the colorectal serrated route.Mutagenesis. 2020 Jul 11;35(3):233-241. doi: 10.1093/mutage/gez039.
• [10] Rheumatoid arthritis susceptibility genes associate with lipid levels in patients with rheumatoid arthritis.Ann Rheum Dis. 2011 Jun;70(6):1025-32. doi: 10.1136/ard.2010.144634. Epub 2011 Mar 11.
• [11] Patient samples of renal cell carcinoma show reduced expression of TRAF1 compared with normal kidney and functional studies in vitro indicate TRAF1 promotes apoptosis: potential for targeted therapy.Pathology. 2012 Aug;44(5):453-9. doi: 10.1097/PAT.0b013e3283557748.
• [12] Regulation of phorbol ester-mediated TRAF1 induction in human colon cancer cells through a PKC/RAF/ERK/NF-kappaB-dependent pathway.Oncogene. 2004 Mar 11;23(10):1885-95. doi: 10.1038/sj.onc.1207312.
• [13] Association of TRAF1/C5 Locus Polymorphisms with Epilepsy and Clinical Traits in Mexican Patients with Neurocysticercosis.Infect Immun. 2019 Nov 18;87(12):e00347-19. doi: 10.1128/IAI.00347-19. Print 2019 Dec.
• [14] Effect of IL-7 Therapy on Phospho-Ribosomal Protein S6 and TRAF1 Expression in HIV-Specific CD8 T Cells in Patients Receiving Antiretroviral Therapy.J Immunol. 2018 Jan 15;200(2):558-564. doi: 10.4049/jimmunol.1601254. Epub 2017 Dec 8.
• [15] Gene expression of tumor necrosis factor receptor associated-factor (TRAF)-1 and TRAF-2 in inflammatory bowel disease.J Dig Dis. 2013 May;14(5):244-50. doi: 10.1111/1751-2980.12044.
• [16] TNF receptor-associated factor (TRAF) domain and Bcl-2 cooperate to induce small B cell lymphoma/chronic lymphocytic leukemia in transgenic mice.Proc Natl Acad Sci U S A. 2004 Nov 23;101(47):16600-5. doi: 10.1073/pnas.0407541101. Epub 2004 Nov 15.
• [17] Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.Ann Neurol. 2011 Dec;70(6):897-912. doi: 10.1002/ana.22609.
• [18] TNF receptor-associated factor 1 as a biomarker for assessment of non-small cell lung cancer metastasis and overall survival.Clin Respir J. 2018 Jul;12(7):2197-2203. doi: 10.1111/crj.12789. Epub 2018 Mar 24.
• [19] Genome-wide DNA methylation analysis of articular chondrocytes identifies TRAF1, CTGF, and CX3CL1 genes as hypomethylated in osteoarthritis.Clin Rheumatol. 2017 Oct;36(10):2335-2342. doi: 10.1007/s10067-017-3667-9. Epub 2017 May 3.
• [20] Identification of genes potentially involved in the acquisition of androgen-independent and metastatic tumor growth in an autochthonous genetically engineered mouse prostate cancer model.Prostate. 2007 Jan 1;67(1):83-106. doi: 10.1002/pros.20505.
• [21] Tumor necrosis factor receptor-associated factor 1 gene overexpression in B-cell chronic lymphocytic leukemia: analysis of NF-kappa B/Rel-regulated inhibitors of apoptosis.Blood. 2002 Nov 15;100(10):3749-56. doi: 10.1182/blood.V100.10.3749.
• [22] TRAF1 Exacerbates Myocardial Ischemia Reperfusion Injury via ASK1-JNK/p38 Signaling.J Am Heart Assoc. 2019 Nov 5;8(21):e012575. doi: 10.1161/JAHA.119.012575. Epub 2019 Oct 25.
• [23] Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.PLoS Genet. 2011 Feb;7(2):e1002004. doi: 10.1371/journal.pgen.1002004. Epub 2011 Feb 24.
• [24] Expression of tumor necrosis factor receptor-associated factor 1 in nasopharyngeal carcinoma: possible upregulation by Epstein-Barr virus latent membrane protein 1.Int J Cancer. 2004 Nov 1;112(2):265-72. doi: 10.1002/ijc.20367.
• [25] Determination of genetic predisposition to patent ductus arteriosus in preterm infants.Pediatrics. 2009 Apr;123(4):1116-23. doi: 10.1542/peds.2008-0313.
• [26] TRAF1 is a critical regulator of cerebral ischaemia-reperfusion injury and neuronal death.Nat Commun. 2013;4:2852. doi: 10.1038/ncomms3852.
• [27] Tumor necrosis factor receptor-associated factor 1 influences KRN/I-Ag7 mouse arthritis autoantibody production.J Clin Immunol. 2013 May;33(4):759-66. doi: 10.1007/s10875-013-9866-5. Epub 2013 Jan 26.
• [28] Prognostic Significance of TNFR-Associated Factor 1 and 2 (TRAF1 and TRAF2) in Glioblastoma.Med Sci Monit. 2017 Sep 19;23:4506-4512. doi: 10.12659/msm.903397.
• [29] Integrative "omic" analysis for tamoxifen sensitivity through cell based models.PLoS One. 2014 Apr 3;9(4):e93420. doi: 10.1371/journal.pone.0093420. eCollection 2014.
• [30] Expression of the tumor necrosis factor receptor-associated factors 1 and 2 and regulation of the nuclear factor-kappaB antiapoptotic activity in human gliomas.J Neurosurg. 2005 Nov;103(5):873-81. doi: 10.3171/jns.2005.103.5.0873.
• [31] TRAF1 Signaling in Human Health and Disease.Front Immunol. 2018 Dec 18;9:2969. doi: 10.3389/fimmu.2018.02969. eCollection 2018.
• [32] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [33] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [34] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [35] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [36] Estradiol and selective estrogen receptor modulators differentially regulate target genes with estrogen receptors alpha and beta. Mol Biol Cell. 2004 Mar;15(3):1262-72. doi: 10.1091/mbc.e03-06-0360. Epub 2003 Dec 29.
• [37] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [38] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [39] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [40] Effects of folate deficiency on gene expression in the apoptosis and cancer pathways in colon cancer cells. Carcinogenesis. 2006 May;27(5):916-24. doi: 10.1093/carcin/bgi312. Epub 2005 Dec 16.
• [41] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [42] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [43] Marked regression of liver metastasis by combined therapy of ultrasound-mediated NF kappaB-decoy transfer and transportal injection of paclitaxel, in mouse. Int J Cancer. 2008 Apr 1;122(7):1645-56. doi: 10.1002/ijc.23280.
• [44] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [45] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [46] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [47] 2,3,7,8-tetrachlorodibenzo-p-dioxin augments the modulation of gene expression mediated by the thyroid hormone receptor. Toxicol Appl Pharmacol. 2004 Feb 1;194(3):201-10. doi: 10.1016/j.taap.2003.09.010.
• [48] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [49] Cytotoxicity of berberine on human cervical carcinoma HeLa cells through mitochondria, death receptor and MAPK pathways, and in-silico drug-target prediction. Toxicol In Vitro. 2010 Sep;24(6):1482-90. doi: 10.1016/j.tiv.2010.07.017. Epub 2010 Jul 23.
• [50] Effects of resveratrol on gene expression in renal cell carcinoma. Cancer Biol Ther. 2004 Sep;3(9):882-8. doi: 10.4161/cbt.3.9.1056. Epub 2004 Sep 21.
• [51] Curcumin (diferuloylmethane) inhibits constitutive NF-kappaB activation, induces G1/S arrest, suppresses proliferation, and induces apoptosis in mantle cell lymphoma. Biochem Pharmacol. 2005 Sep 1;70(5):700-13. doi: 10.1016/j.bcp.2005.04.043.
• [52] N-(4-hydroxyphenyl)retinamide inhibits invasion, suppresses osteoclastogenesis, and potentiates apoptosis through down-regulation of I(kappa)B(alpha) kinase and nuclear factor-kappaB-regulated gene products. Cancer Res. 2005 Oct 15;65(20):9555-65. doi: 10.1158/0008-5472.CAN-05-1585.
• [53] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [54] Sensitivity of human lung adenocarcinoma cell lines to targeted inhibition of BET epigenetic signaling proteins. Proc Natl Acad Sci U S A. 2012 Nov 20;109(47):19408-13. doi: 10.1073/pnas.1216363109. Epub 2012 Nov 5.
• [55] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [56] Global expression profiling of theophylline response genes in macrophages: evidence of airway anti-inflammatory regulation. Respir Res. 2005 Aug 8;6(1):89. doi: 10.1186/1465-9921-6-89.
• [57] Cytotoxicity of dioscin in human gastric carcinoma cells through death receptor and mitochondrial pathways. J Appl Toxicol. 2013 Aug;33(8):712-22. doi: 10.1002/jat.2715. Epub 2012 Feb 14.
• [58] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [59] Apoptotic effects of rhein through the mitochondrial pathways, two death receptor pathways, and reducing autophagy in human liver L02 cells. Environ Toxicol. 2019 Dec;34(12):1292-1302. doi: 10.1002/tox.22830. Epub 2019 Aug 21.
• [60] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.