Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUA4FFH)

• DOT Name: Metallothionein-1B (MT1B)
• Synonyms: MT-1B; Metallothionein-IB; MT-IB
• Gene Name: MT1B
• Related Disease:
  Abetalipoproteinemia
  Amyotrophic lateral sclerosis type 1
  Androgen insensitivity syndrome
  Breast cancer
  Breast carcinoma
  Cardiovascular disease
  Chronic kidney disease
  Classic Hodgkin lymphoma
  Colonic neoplasm
  Cone-rod dystrophy 2
  Glioma
  Gout
  Graves disease
  Hepatitis C virus infection
  Hepatocellular carcinoma
  Homozygous familial hypercholesterolemia
  Huntington disease
  Hyperinsulinemia
  Hyperlipidemia
  Hypobetalipoproteinemia
  Hypothyroidism
  Laryngeal carcinoma
  Laryngeal squamous cell carcinoma
  Malignant pleural mesothelioma
  Nephritis
  Non-alcoholic steatohepatitis
  Peripheral arterial disease
  Peripheral vascular disease
  Schizophrenia
  Systemic lupus erythematosus
  Amyotrophic lateral sclerosis
  Lung cancer
  Lung carcinoma
  Obesity
  Adenocarcinoma
  Non-alcoholic fatty liver disease
  Non-small-cell lung cancer
  Advanced cancer
  Breast neoplasm
  Cardiomyopathy
  Fatty liver disease
  Glaucoma/ocular hypertension
  Lupus nephritis
  Non-insulin dependent diabetes
  Prostate cancer
  Prostate carcinoma
  Stroke
• UniProt ID: MT1B_HUMAN
• Pfam ID: PF00131
• Sequence:
  MDPNCSCTTGGSCACAGSCKCKECKCTSCKKCCCSCCPVGCAKCAQGCVCKGSSEKCRCC
  A
• Function: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
• KEGG Pathway: Mineral absorption (hsa04978)
• Reactome Pathway: Metallothioneins bind metals (R-HSA-5661231)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Abetalipoproteinemia	DISMSS7T	Definitive	Genetic Variation	[1]
Amyotrophic lateral sclerosis type 1	DIS5A2M0	Strong	Biomarker	[2]
Androgen insensitivity syndrome	DISUZBBO	Strong	Altered Expression	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[5]
Chronic kidney disease	DISW82R7	Strong	Altered Expression	[6]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Genetic Variation	[7]
Colonic neoplasm	DISSZ04P	Strong	Posttranslational Modification	[8]
Cone-rod dystrophy 2	DISX2RWY	Strong	Genetic Variation	[9]
Glioma	DIS5RPEH	Strong	Biomarker	[10]
Gout	DISHC0U7	Strong	Biomarker	[11]
Graves disease	DISU4KOQ	Strong	Biomarker	[12]
Hepatitis C virus infection	DISQ0M8R	Strong	Genetic Variation	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[14]
Homozygous familial hypercholesterolemia	DISRCNCF	Strong	Genetic Variation	[15]
Huntington disease	DISQPLA4	Strong	Altered Expression	[16]
Hyperinsulinemia	DISIDWT6	Strong	Biomarker	[17]
Hyperlipidemia	DIS61J3S	Strong	Genetic Variation	[18]
Hypobetalipoproteinemia	DIS0TPI3	Strong	Altered Expression	[1]
Hypothyroidism	DISR0H6D	Strong	Biomarker	[19]
Laryngeal carcinoma	DISNHCIV	Strong	Biomarker	[20]
Laryngeal squamous cell carcinoma	DIS9UUVF	Strong	Biomarker	[20]
Malignant pleural mesothelioma	DIST2R60	Strong	Biomarker	[21]
Nephritis	DISQZQ70	Strong	Altered Expression	[22]
Non-alcoholic steatohepatitis	DIST4788	Strong	Genetic Variation	[23]
Peripheral arterial disease	DIS78WFB	Strong	Genetic Variation	[24]
Peripheral vascular disease	DISXSU1Y	Strong	Genetic Variation	[24]
Schizophrenia	DISSRV2N	Strong	Biomarker	[25]
Systemic lupus erythematosus	DISI1SZ7	Strong	Altered Expression	[22]
Amyotrophic lateral sclerosis	DISF7HVM	moderate	Altered Expression	[26]
Lung cancer	DISCM4YA	moderate	Genetic Variation	[27]
Lung carcinoma	DISTR26C	moderate	Genetic Variation	[27]
Obesity	DIS47Y1K	moderate	Biomarker	[28]
Adenocarcinoma	DIS3IHTY	Disputed	Altered Expression	[29]
Non-alcoholic fatty liver disease	DISDG1NL	Disputed	Genetic Variation	[30]
Non-small-cell lung cancer	DIS5Y6R9	Disputed	Biomarker	[29]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[31]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[32]
Cardiomyopathy	DISUPZRG	Limited	Biomarker	[33]
Fatty liver disease	DIS485QZ	Limited	Genetic Variation	[23]
Glaucoma/ocular hypertension	DISLBXBY	Limited	Genetic Variation	[34]
Lupus nephritis	DISCVGPZ	Limited	Altered Expression	[35]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Altered Expression	[36]
Prostate cancer	DISF190Y	Limited	Altered Expression	[37]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[37]
Stroke	DISX6UHX	Limited	Biomarker	[38]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Metallothionein-1B (MT1B).	[39]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Metallothionein-1B (MT1B).	[40]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Metallothionein-1B (MT1B).	[41]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Metallothionein-1B (MT1B).	[42]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Metallothionein-1B (MT1B).	[43]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Metallothionein-1B (MT1B).	[44]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Metallothionein-1B (MT1B).	[45]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Metallothionein-1B (MT1B).	[46]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Metallothionein-1B (MT1B).	[47]
Promegestone	DMK4S8I	Approved	Promegestone increases the expression of Metallothionein-1B (MT1B).	[48]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Metallothionein-1B (MT1B).	[49]
Disulfiram	DMCL2OK	Phase 2 Trial	Disulfiram increases the expression of Metallothionein-1B (MT1B).	[50]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Metallothionein-1B (MT1B).	[51]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Metallothionein-1B (MT1B).	[52]
Pyrrolidine dithiocarbamate	DM5ZAS6	Investigative	Pyrrolidine dithiocarbamate increases the expression of Metallothionein-1B (MT1B).	[53]

References

• [1] Hypobetalipoproteinemia and abetalipoproteinemia.Curr Opin Lipidol. 2014 Jun;25(3):161-8. doi: 10.1097/MOL.0000000000000072.
• [2] Reduction of metallothioneins promotes the disease expression of familial amyotrophic lateral sclerosis mice in a dose-dependent manner.Eur J Neurosci. 2001 Apr;13(7):1363-70. doi: 10.1046/j.0953-816x.2001.01512.x.
• [3] Abnormal melatonin receptor 1B expression in osteoblasts from girls with adolescent idiopathic scoliosis.J Pineal Res. 2011 May;50(4):395-402. doi: 10.1111/j.1600-079X.2011.00857.x. Epub 2011 Feb 24.
• [4] A case-control study of Metallothionein-1 expression in breast cancer and breast fibroadenoma.Sci Rep. 2019 May 15;9(1):7407. doi: 10.1038/s41598-019-43565-0.
• [5] Abetalipoproteinemia: two case reports and literature review.Orphanet J Rare Dis. 2008 Jul 8;3:19. doi: 10.1186/1750-1172-3-19.
• [6] Identification of serum metabolites associating with chronic kidney disease progression and anti-fibrotic effect of 5-methoxytryptophan.Nat Commun. 2019 Apr 1;10(1):1476. doi: 10.1038/s41467-019-09329-0.
• [7] A novel MspI PCR-RFLP in the human cytosine 5-methyltransferase gene: lack of relevance for malignant lymphoproliferative disease and breast cancer.Hum Hered. 1998 Jul-Aug;48(4):226-9. doi: 10.1159/000022805.
• [8] Induction of apoptosis by wild-type p53 in a human colon tumor-derived cell line.Proc Natl Acad Sci U S A. 1992 May 15;89(10):4495-9. doi: 10.1073/pnas.89.10.4495.
• [9] Molecular diagnosis of hypobetalipoproteinemia: an ENID review. Atherosclerosis. 2007 Dec;195(2):e19-27. doi: 10.1016/j.atherosclerosis.2007.05.003. Epub 2007 Jun 14.
• [10] The melatonin-MT1 receptor axis modulates tumor growth in PTEN-mutated gliomas.Biochem Biophys Res Commun. 2018 Feb 19;496(4):1322-1330. doi: 10.1016/j.bbrc.2018.02.010.
• [11] Ultrasonographic detection of double contour sign and hyperechoic aggregates for diagnosis of gout: two sites examination is as good as six sites examination.Int J Rheum Dis. 2018 Feb;21(2):523-531. doi: 10.1111/1756-185X.13235. Epub 2017 Dec 5.
• [12] Expression of Metallothionein I/II and Ki-67 Antigen in Graves' Disease.Anticancer Res. 2018 Dec;38(12):6847-6853. doi: 10.21873/anticanres.13059.
• [13] Association between hepatic steatosis and MTP gene -493G/T polymorphism in the patients with HCV genotype 1 infection.Infect Genet Evol. 2019 Jun;70:101-106. doi: 10.1016/j.meegid.2019.02.019. Epub 2019 Feb 18.
• [14] Prognostic Significance of 14-3-3, Aldo-keto Reductase Family 1 B10 and Metallothionein-1 in Hepatocellular Carcinoma.Anticancer Res. 2018 Dec;38(12):6855-6863. doi: 10.21873/anticanres.13060.
• [15] MTP Gene Variants and Response to Lomitapide in Patients with Homozygous Familial Hypercholesterolemia.J Atheroscler Thromb. 2016 Jul 1;23(7):878-83. doi: 10.5551/jat.34777. Epub 2016 May 10.
• [16] The melatonin MT1 receptor axis modulates mutant Huntingtin-mediated toxicity.J Neurosci. 2011 Oct 12;31(41):14496-507. doi: 10.1523/JNEUROSCI.3059-11.2011.
• [17] Liver microsomal triglyceride transfer protein is involved in hepatitis C liver steatosis.Gastroenterology. 2006 May;130(6):1661-9. doi: 10.1053/j.gastro.2006.02.035. Epub 2006 Mar 6.
• [18] Association of L-FABP T94A and MTP I128T polymorphisms with hyperlipidemia in Chinese subjects.Lipids. 2015 Mar;50(3):275-82. doi: 10.1007/s11745-015-3990-3. Epub 2015 Feb 7.
• [19] Modulation of mitochondrial transition pore components by thyroid hormone.Endocrinology. 2005 May;146(5):2462-72. doi: 10.1210/en.2004-1161. Epub 2005 Feb 3.
• [20] Potential biomarkers for head and neck squamous cell carcinoma.Laryngoscope. 2003 Mar;113(3):393-400. doi: 10.1097/00005537-200303000-00001.
• [21] Immunohistochemically detectable metallothionein expression in malignant pleural mesotheliomas is strongly associated with early failure to platin-based chemotherapy.Oncotarget. 2018 Apr 27;9(32):22254-22268. doi: 10.18632/oncotarget.24962. eCollection 2018 Apr 27.
• [22] The renal metallothionein expression profile is altered in human lupus nephritis.Arthritis Res Ther. 2008;10(4):R76. doi: 10.1186/ar2450. Epub 2008 Jul 6.
• [23] Association of polymorphisms of glutamate-cystein ligase and microsomal triglyceride transfer protein genes in non-alcoholic fatty liver disease.J Gastroenterol Hepatol. 2010 Feb;25(2):357-61. doi: 10.1111/j.1440-1746.2009.06001.x. Epub 2009 Oct 9.
• [24] The MTP -493TT genotype is associated with peripheral arterial disease: results from the Linz Peripheral Arterial Disease (LIPAD) Study.Clin Biochem. 2008 Jun;41(9):712-6. doi: 10.1016/j.clinbiochem.2008.02.007. Epub 2008 Feb 21.
• [25] Auditory steady state response in the schizophrenia, first-degree relatives, and schizotypal personality disorder.Schizophr Res. 2012 Apr;136(1-3):143-9. doi: 10.1016/j.schres.2012.01.003. Epub 2012 Jan 28.
• [26] Expression of different metallothionein messenger ribonucleic acids in motor cortex, spinal cord and liver from patients with amyotrophic lateral sclerosis.J Neurol Sci. 1996 Oct;142(1-2):39-44. doi: 10.1016/0022-510x(96)00013-5.
• [27] Impact of metallothionein gene polymorphisms on the risk of lung cancer in a Japanese population.Mol Carcinog. 2015 Jun;54 Suppl 1:E122-8. doi: 10.1002/mc.22198. Epub 2014 Aug 30.
• [28] Syzygium cumini Leaf Extract Reverts Hypertriglyceridemia via Downregulation of the Hepatic XBP-1s/PDI/MTP Axis in Monosodium L-Glutamate-Induced Obese Rats.Oxid Med Cell Longev. 2019 Mar 21;2019:9417498. doi: 10.1155/2019/9417498. eCollection 2019.
• [29] Metallothionein 1F and 2A overexpression predicts poor outcome of non-small cell lung cancer patients.Exp Mol Pathol. 2013 Feb;94(1):301-8. doi: 10.1016/j.yexmp.2012.10.006. Epub 2012 Oct 9.
• [30] Correlation between MTP -493G>T polymorphism and non-alcoholic fatty liver disease risk: a meta-analysis.Genet Mol Res. 2014 Dec 4;13(4):10150-61. doi: 10.4238/2014.December.4.9.
• [31] Patient perspectives on molecular tumor profiling: "Why wouldn't you?".BMC Cancer. 2019 Jul 31;19(1):753. doi: 10.1186/s12885-019-5920-x.
• [32] Immunohistochemical Expression of Melatonin Receptor MT1 and Glucose Transporter GLUT1 in Human Breast Cancer.Anticancer Agents Med Chem. 2018;18(15):2110-2116. doi: 10.2174/1871520618666181025125532.
• [33] Clinical and genetic characteristics of patients with fatty acid oxidation disorders identified by newborn screening.BMC Pediatr. 2018 Mar 8;18(1):103. doi: 10.1186/s12887-018-1069-z.
• [34] Variations in the myocilin gene in patients with open-angle glaucoma.Arch Ophthalmol. 2002 Sep;120(9):1189-97. doi: 10.1001/archopht.120.9.1189.
• [35] The role of 5-methoxytryptophan in pediatric-onset lupus nephritis: A retrospective cohort study.J Microbiol Immunol Infect. 2020 Oct;53(5):797-802. doi: 10.1016/j.jmii.2018.12.003. Epub 2018 Dec 19.
• [36] Metallothionein-mediated antioxidant defense system and its response to exercise training are impaired in human type 2 diabetes.Diabetes. 2005 Nov;54(11):3089-94. doi: 10.2337/diabetes.54.11.3089.
• [37] Melatonin MT1 receptor-induced transcriptional up-regulation of p27(Kip1) in prostate cancer antiproliferation is mediated via inhibition of constitutively active nuclear factor kappa B (NF-B): potential implications on prostate cancer chemoprevention and therapy.J Pineal Res. 2013 Jan;54(1):69-79. doi: 10.1111/j.1600-079X.2012.01026.x. Epub 2012 Aug 1.
• [38] Metallothionein I as a direct link between therapeutic hematopoietic stem/progenitor cells and cerebral protection in stroke.FASEB J. 2018 May;32(5):2381-2394. doi: 10.1096/fj.201700746R. Epub 2017 Dec 21.
• [39] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
• [40] Gene expression changes associated with cytotoxicity identified using cDNA arrays. Funct Integr Genomics. 2000 Sep;1(2):114-26.
• [41] Extremely low copper concentrations affect gene expression profiles of human prostate epithelial cell lines. Chem Biol Interact. 2010 Oct 6;188(1):214-9.
• [42] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [43] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [44] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [45] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [46] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [47] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [48] Short-chain fatty acids enhance nuclear receptor activity through mitogen-activated protein kinase activation and histone deacetylase inhibition. Proc Natl Acad Sci U S A. 2004 May 4;101(18):7199-204.
• [49] Application of the adverse outcome pathway concept for investigating developmental neurotoxicity potential of Chinese herbal medicines by using human neural progenitor cells in vitro. Cell Biol Toxicol. 2023 Feb;39(1):319-343. doi: 10.1007/s10565-022-09730-4. Epub 2022 Jun 15.
• [50] High-throughput cell-based screening of 4910 known drugs and drug-like small molecules identifies disulfiram as an inhibitor of prostate cancer cell growth. Clin Cancer Res. 2009 Oct 1;15(19):6070-8.
• [51] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [52] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [53] Effects of a redox-active agent on lymphocyte activation and early gene expression patterns. Free Radic Biol Med. 2004 Nov 15;37(10):1550-63.