Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZF6K1H)

• DOT Name: Protein BTG2 (BTG2)
• Synonyms: BTG family member 2; NGF-inducible anti-proliferative protein PC3
• Gene Name: BTG2
• Related Disease:
  Advanced cancer
  B-cell lymphoma
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Central nervous system lymphoma
  Clear cell renal carcinoma
  Estrogen-receptor positive breast cancer
  Graves disease
  Hepatocellular carcinoma
  Her2-receptor negative breast cancer
  Kidney cancer
  Laryngeal carcinoma
  Medulloblastoma
  Metastatic malignant neoplasm
  Neoplasm
  Neuroblastoma
  Prostate cancer
  Renal carcinoma
  Skin cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Adult glioblastoma
  Glioblastoma multiforme
  Lung cancer
  Lung carcinoma
  Triple negative breast cancer
  Adult lymphoma
  Castration-resistant prostate carcinoma
  Gastric cancer
  Lymphoma
  Non-small-cell lung cancer
  Pachyonychia congenita 3
  Pancreatic cancer
  Pediatric lymphoma
  Prostate carcinoma
  Small lymphocytic lymphoma
  Stomach cancer
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
• UniProt ID: BTG2_HUMAN
• PDB ID: 3DJU; 3E9V
• Pfam ID: PF07742
• Sequence:
  MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPS
  KGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSIC
  VLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS
• Function: Anti-proliferative protein; the function is mediated by association with deadenylase subunits of the CCR4-NOT complex. Activates mRNA deadenylation in a CNOT6 and CNOT7-dependent manner. In vitro can inhibit deadenylase activity of CNOT7 and CNOT8. Involved in cell cycle regulation. Could be involved in the growth arrest and differentiation of the neuronal precursors. Modulates transcription regulation mediated by ESR1. Involved in mitochondrial depolarization and neurite outgrowth.
• KEGG Pathway: R. degradation (hsa03018)
• Reactome Pathway: TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain (R-HSA-6804115)

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[1]
B-cell lymphoma	DISIH1YQ	Strong	Genetic Variation	[2]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[6]
Central nervous system lymphoma	DISBYQTA	Strong	Biomarker	[2]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[7]
Estrogen-receptor positive breast cancer	DIS1H502	Strong	Altered Expression	[8]
Graves disease	DISU4KOQ	Strong	Genetic Variation	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[10]
Her2-receptor negative breast cancer	DISS605N	Strong	Biomarker	[8]
Kidney cancer	DISBIPKM	Strong	Altered Expression	[11]
Laryngeal carcinoma	DISNHCIV	Strong	Biomarker	[12]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[13]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[14]
Neoplasm	DISZKGEW	Strong	Altered Expression	[15]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[16]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[17]
Renal carcinoma	DISER9XT	Strong	Altered Expression	[11]
Skin cancer	DISTM18U	Strong	Biomarker	[18]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[3]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[3]
Adult glioblastoma	DISVP4LU	moderate	Biomarker	[19]
Glioblastoma multiforme	DISK8246	moderate	Biomarker	[19]
Lung cancer	DISCM4YA	moderate	Biomarker	[20]
Lung carcinoma	DISTR26C	moderate	Biomarker	[20]
Triple negative breast cancer	DISAMG6N	moderate	Biomarker	[21]
Adult lymphoma	DISK8IZR	Limited	Biomarker	[1]
Castration-resistant prostate carcinoma	DISVGAE6	Limited	Altered Expression	[22]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[23]
Lymphoma	DISN6V4S	Limited	Biomarker	[1]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Biomarker	[24]
Pachyonychia congenita 3	DISZLC6C	Limited	Altered Expression	[25]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[26]
Pediatric lymphoma	DIS51BK2	Limited	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Limited	Genetic Variation	[17]
Small lymphocytic lymphoma	DIS30POX	Limited	Biomarker	[1]
Stomach cancer	DISKIJSX	Limited	Altered Expression	[23]
Thyroid cancer	DIS3VLDH	Limited	Altered Expression	[27]
Thyroid gland carcinoma	DISMNGZ0	Limited	Altered Expression	[27]
Thyroid tumor	DISLVKMD	Limited	Altered Expression	[27]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	Protein BTG2 (BTG2) affects the response to substance of Methotrexate.	[65]

48 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein BTG2 (BTG2).	[28]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein BTG2 (BTG2).	[29]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Protein BTG2 (BTG2).	[30]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein BTG2 (BTG2).	[31]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Protein BTG2 (BTG2).	[32]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein BTG2 (BTG2).	[33]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein BTG2 (BTG2).	[34]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Protein BTG2 (BTG2).	[35]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Protein BTG2 (BTG2).	[36]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Protein BTG2 (BTG2).	[37]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Protein BTG2 (BTG2).	[38]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Protein BTG2 (BTG2).	[39]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Protein BTG2 (BTG2).	[39]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Protein BTG2 (BTG2).	[40]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Protein BTG2 (BTG2).	[29]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Protein BTG2 (BTG2).	[38]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Protein BTG2 (BTG2).	[41]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Protein BTG2 (BTG2).	[42]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Protein BTG2 (BTG2).	[43]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Protein BTG2 (BTG2).	[44]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Protein BTG2 (BTG2).	[45]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Protein BTG2 (BTG2).	[46]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Protein BTG2 (BTG2).	[29]
Melphalan	DMOLNHF	Approved	Melphalan increases the expression of Protein BTG2 (BTG2).	[47]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide increases the expression of Protein BTG2 (BTG2).	[48]
Zidovudine	DM4KI7O	Approved	Zidovudine increases the expression of Protein BTG2 (BTG2).	[49]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Protein BTG2 (BTG2).	[29]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Protein BTG2 (BTG2).	[29]
Colchicine	DM2POTE	Approved	Colchicine decreases the expression of Protein BTG2 (BTG2).	[46]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea increases the expression of Protein BTG2 (BTG2).	[46]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil increases the expression of Protein BTG2 (BTG2).	[29]
Adenine	DMZLHKJ	Approved	Adenine decreases the expression of Protein BTG2 (BTG2).	[46]
Vitamin A	DMJ2AH4	Approved	Vitamin A increases the expression of Protein BTG2 (BTG2).	[50]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Protein BTG2 (BTG2).	[30]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine increases the expression of Protein BTG2 (BTG2).	[51]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Protein BTG2 (BTG2).	[52]
Delphinidin	DMS2WIN	Phase 2	Delphinidin affects the expression of Protein BTG2 (BTG2).	[53]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Protein BTG2 (BTG2).	[54]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Protein BTG2 (BTG2).	[55]
UNC0379	DMD1E4J	Preclinical	UNC0379 increases the expression of Protein BTG2 (BTG2).	[56]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Protein BTG2 (BTG2).	[57]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Protein BTG2 (BTG2).	[58]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Protein BTG2 (BTG2).	[59]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Protein BTG2 (BTG2).	[60]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Protein BTG2 (BTG2).	[61]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Protein BTG2 (BTG2).	[62]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Protein BTG2 (BTG2).	[63]
9-hydroxyoctadecadienoic acid	DM0FWNJ	Investigative	9-hydroxyoctadecadienoic acid increases the expression of Protein BTG2 (BTG2).	[64]

References

• [1] Tumor suppressors BTG1 and BTG2: Beyond growth control.J Cell Physiol. 2019 May;234(5):5379-5389. doi: 10.1002/jcp.27407. Epub 2018 Oct 23.
• [2] Genomic characterization of primary central nervous system lymphoma.Acta Neuropathol. 2016 Jun;131(6):865-75. doi: 10.1007/s00401-016-1536-2. Epub 2016 Jan 12.
• [3] BTG2 is a tumor suppressor gene upregulated by p53 and PTEN in human bladder carcinoma cells.Cancer Med. 2018 Jan;7(1):184-195. doi: 10.1002/cam4.1263. Epub 2017 Dec 13.
• [4] Translational downregulation of Twist1 expression by antiproliferative gene, B-cell translocation gene 2, in the triple negative breast cancer cells.Cell Death Dis. 2019 May 28;10(6):410. doi: 10.1038/s41419-019-1640-z.
• [5] Expression and prognosis analyses of the Tob/BTG antiproliferative (APRO) protein family in human cancers.PLoS One. 2017 Sep 18;12(9):e0184902. doi: 10.1371/journal.pone.0184902. eCollection 2017.
• [6] Breast tumor progression induced by loss of BTG2 expression is inhibited by targeted therapy with the ErbB/HER inhibitor lapatinib.Oncogene. 2011 Jul 7;30(27):3084-95. doi: 10.1038/onc.2011.24. Epub 2011 Feb 21.
• [7] Overexpression of BTG2 suppresses growth, migration, and invasion of human renal carcinoma cells in vitro.Neoplasma. 2016;63(3):385-93. doi: 10.4149/307_150822N455.
• [8] Loss of B-cell translocation gene 2 expression in estrogen receptor-positive breast cancer predicts tamoxifen resistance.Cancer Sci. 2014 Jun;105(6):675-82. doi: 10.1111/cas.12410. Epub 2014 May 2.
• [9] Association of BTG2, CYR61, ZFP36, and SCD gene polymorphisms with Graves' disease and ophthalmopathy.Thyroid. 2014 Jul;24(7):1156-61. doi: 10.1089/thy.2013.0654. Epub 2014 Jun 3.
• [10] MiR-6875-3p promotes the proliferation, invasion and metastasis of hepatocellular carcinoma via BTG2/FAK/Akt pathway.J Exp Clin Cancer Res. 2019 Jan 8;38(1):7. doi: 10.1186/s13046-018-1020-z.
• [11] Impaired expression of the cell cycle regulator BTG2 is common in clear cell renal cell carcinoma.Cancer Res. 2004 Mar 1;64(5):1632-8. doi: 10.1158/0008-5472.can-03-1687.
• [12] Regulation of the cell cycle gene, BTG2, by miR-21 in human laryngeal carcinoma.Cell Res. 2009 Jul;19(7):828-37. doi: 10.1038/cr.2009.72.
• [13] Tis21-gene therapy inhibits medulloblastoma growth in a murine allograft model.PLoS One. 2018 Mar 14;13(3):e0194206. doi: 10.1371/journal.pone.0194206. eCollection 2018.
• [14] Small interfering RNA-directed targeting of Toll-like receptor 4 inhibits human prostate cancer cell invasion, survival, and tumorigenicity.Mol Immunol. 2009 Sep;46(15):2876-84. doi: 10.1016/j.molimm.2009.06.016. Epub 2009 Jul 29.
• [15] Inhibition of Notch signaling attenuates pituitary adenoma growth in Nude mice.Endocr Relat Cancer. 2019 Jan 1;26(1):13-29. doi: 10.1530/ERC-18-0337.
• [16] The neurogene BTG2TIS21/PC3 is transactivated by DeltaNp73alpha via p53 specifically in neuroblastoma cells.J Cell Sci. 2005 Mar 15;118(Pt 6):1245-53. doi: 10.1242/jcs.01704. Epub 2005 Mar 1.
• [17] Global transcriptome analysis of formalin-fixed prostate cancer specimens identifies biomarkers of disease recurrence.Cancer Res. 2014 Jun 15;74(12):3228-37. doi: 10.1158/0008-5472.CAN-13-2699. Epub 2014 Apr 8.
• [18] Inhibitory effects of Bcell translocation gene2 on skin cancer cells via the Wnt/catenin signaling pathway.Mol Med Rep. 2016 Oct;14(4):3464-8. doi: 10.3892/mmr.2016.5596. Epub 2016 Aug 8.
• [19] miR?7a suppresses the clonogenic growth and migration of human glioblastoma multiforme cells by targeting BTG2.Int J Oncol. 2015 Apr;46(4):1601-8. doi: 10.3892/ijo.2015.2843. Epub 2015 Jan 22.
• [20] Gamma Irradiation Upregulates B-cell Translocation Gene 2 to Attenuate Cell Proliferation of Lung Cancer Cells Through the JNK and NF-B Pathways.Oncol Res. 2017 Aug 7;25(7):1199-1205. doi: 10.3727/096504017X14873444858101. Epub 2017 Mar 2.
• [21] MiR-25-3p promotes the proliferation of triple negative breast cancer by targeting BTG2.Mol Cancer. 2018 Jan 8;17(1):4. doi: 10.1186/s12943-017-0754-0.
• [22] Androgen-regulated miR-32 targets BTG2 and is overexpressed in castration-resistant prostate cancer.Oncogene. 2012 Oct 11;31(41):4460-71. doi: 10.1038/onc.2011.624. Epub 2012 Jan 23.
• [23] Inhibition of TNF-interacting protein (Tip)-associated gastric carcinogenesis by BTG2(/TIS21) via downregulating cytoplasmic nucleolin expression.Exp Mol Med. 2018 Feb 23;50(2):e449. doi: 10.1038/emm.2017.281.
• [24] A multi-omic study reveals BTG2 as a reliable prognostic marker for early-stage non-small cell lung cancer.Mol Oncol. 2018 Jun;12(6):913-924. doi: 10.1002/1878-0261.12204. Epub 2018 May 4.
• [25] BTG2 suppresses cancer cell migration through inhibition of Src-FAK signaling by downregulation of reactive oxygen species generation in mitochondria.Clin Exp Metastasis. 2012 Dec;29(8):901-13. doi: 10.1007/s10585-012-9479-z. Epub 2012 May 6.
• [26] Pancreatic cancer cell-derived exosomal microRNA-27a promotes angiogenesis of human microvascular endothelial cells in pancreatic cancer via BTG2.J Cell Mol Med. 2020 Jan;24(1):588-604. doi: 10.1111/jcmm.14766. Epub 2019 Nov 13.
• [27] Iodine-131 treatment of thyroid cancer cells leads to suppression of cell proliferation followed by induction of cell apoptosis and cell cycle arrest by regulation of B-cell translocation gene 2-mediated JNK/NF-B pathways.Braz J Med Biol Res. 2017 Jan 16;50(1):e5933. doi: 10.1590/1414-431X20165933.
• [28] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [29] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [30] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [31] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [32] Doxorubicin induces cell senescence preferentially over apoptosis in the FU-SY-1 synovial sarcoma cell line. J Orthop Res. 2006 Jun;24(6):1163-9. doi: 10.1002/jor.20169.
• [33] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [34] Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
• [35] Combined effects of arsenic and palmitic acid on oxidative stress and lipid metabolism disorder in human hepatoma HepG2 cells. Sci Total Environ. 2021 May 15;769:144849. doi: 10.1016/j.scitotenv.2020.144849. Epub 2021 Jan 19.
• [36] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [37] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [38] Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
• [39] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [40] Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
• [41] Apoptosis, cell cycle progression and gene expression in TP53-depleted HCT116 colon cancer cells in response to short-term 5-fluorouracil treatment. Int J Oncol. 2007 Dec;31(6):1491-500.
• [42] Gene expression profile of human lymphoid CEM cells sensitive and resistant to glucocorticoid-evoked apoptosis. Genomics. 2003 Jun;81(6):543-55.
• [43] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [44] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [45] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [46] Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
• [47] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [48] Comparison of Drug Metabolism and Its Related Hepatotoxic Effects in HepaRG, Cryopreserved Human Hepatocytes, and HepG2 Cell Cultures. Biol Pharm Bull. 2018 May 1;41(5):722-732. doi: 10.1248/bpb.b17-00913. Epub 2018 Feb 14.
• [49] Role of DNA Repair Pathways in Response to Zidovudine-induced DNA Damage in Immortalized Human Liver THLE2 Cells. Int J Biomed Sci. 2013 Mar;9(1):18-25.
• [50] Suppression of mammary carcinoma cell growth by retinoic acid: the cell cycle control gene Btg2 is a direct target for retinoic acid receptor signaling. Cancer Res. 2007 Jan 15;67(2):609-15. doi: 10.1158/0008-5472.CAN-06-0989.
• [51] Effects of chlorpromazine with and without UV irradiation on gene expression of HepG2 cells. Mutat Res. 2005 Aug 4;575(1-2):47-60. doi: 10.1016/j.mrfmmm.2005.03.002. Epub 2005 Apr 26.
• [52] Changes in gene expressions elicited by physiological concentrations of genistein on human endometrial cancer cells. Mol Carcinog. 2006 Oct;45(10):752-63.
• [53] Delphinidin modulates the DNA-damaging properties of topoisomerase II poisons. Chem Res Toxicol. 2009 Mar 16;22(3):554-64. doi: 10.1021/tx800293v.
• [54] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [55] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [56] Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
• [57] Quercetin and Its Fermented Extract as a Potential Inhibitor of Bisphenol A-Exposed HT-29 Colon Cancer Cells' Viability. Int J Mol Sci. 2023 Mar 15;24(6):5604. doi: 10.3390/ijms24065604.
• [58] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [59] Identification of gene markers for formaldehyde exposure in humans. Environ Health Perspect. 2007 Oct;115(10):1460-6. doi: 10.1289/ehp.10180.
• [60] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [61] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [62] p53 activation by Ni(II) is a HIF-1 independent response causing caspases 9/3-mediated apoptosis in human lung cells. Toxicol Appl Pharmacol. 2013 Jun 15;269(3):233-9. doi: 10.1016/j.taap.2013.03.023. Epub 2013 Apr 6.
• [63] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [64] Linoleic acid derivatives target miR-361-3p/BTG2 to confer anticancer effects in acute myeloid leukemia. J Biochem Mol Toxicol. 2023 Nov;37(11):e23481. doi: 10.1002/jbt.23481. Epub 2023 Jul 27.
• [65] Differential gene expression profiles may differentiate responder and nonresponder patients with rheumatoid arthritis for methotrexate (MTX) monotherapy and MTX plus tumor necrosis factor inhibitor combined therapy. J Rheumatol. 2012 Aug;39(8):1524-32. doi: 10.3899/jrheum.120092. Epub 2012 Jul 1.