Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1K68KE)

• DOT Name: Cystatin-A (CSTA)
• Synonyms: Cystatin-AS; Stefin-A
• Gene Name: CSTA
• Related Disease:
  Psoriasis
  Adenocarcinoma
  Advanced cancer
  Anxiety
  Anxiety disorder
  Asthma
  Atopic dermatitis
  Benign prostatic hyperplasia
  Brain neoplasm
  Breast carcinoma
  Chronic obstructive pulmonary disease
  Craniosynostosis
  Depression
  Ductal breast carcinoma in situ
  Esophageal squamous cell carcinoma
  Exanthem
  Generalized anxiety disorder
  Glaucoma/ocular hypertension
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Invasive breast carcinoma
  Laryngeal carcinoma
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Maxillary sinusitis
  Melanoma
  Nasopharyngeal carcinoma
  Neoplasm
  Non-small-cell lung cancer
  Osteoarthritis
  Peeling skin syndrome 4
  Post-traumatic stress disorder
  Squamous cell carcinoma
  Type-1/2 diabetes
  Glioblastoma multiforme
  Obesity
  Acral peeling skin syndrome
  Exfoliative ichthyosis
  Breast cancer
  Breast neoplasm
  Invasive ductal breast carcinoma
  Matthew-Wood syndrome
  Metastatic malignant neoplasm
  Pancreatic ductal carcinoma
• UniProt ID: CYTA_HUMAN
• PDB ID: 1CYU; 1CYV; 1DVC; 1DVD; 1GD3; 1GD4; 1N9J; 1NB3; 1NB5; 3K9M; 3KFQ; 3KSE; 8GT0; 8GT7
• Pfam ID: PF00031
• Sequence:
  MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAG
  DNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
• Function: This is an intracellular thiol proteinase inhibitor. Has an important role in desmosome-mediated cell-cell adhesion in the lower levels of the epidermis.
• Tissue Specificity: Expressed in the skin throughout the epidermis.
• Reactome Pathway: Formation of the cornified envelope (R-HSA-6809371)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Psoriasis	DIS59VMN	Definitive	Biomarker	[1]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Anxiety	DISIJDBA	Strong	Biomarker	[4]
Anxiety disorder	DISBI2BT	Strong	Biomarker	[4]
Asthma	DISW9QNS	Strong	Genetic Variation	[5]
Atopic dermatitis	DISTCP41	Strong	Genetic Variation	[5]
Benign prostatic hyperplasia	DISI3CW2	Strong	Biomarker	[6]
Brain neoplasm	DISY3EKS	Strong	Biomarker	[7]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[8]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Altered Expression	[9]
Craniosynostosis	DIS6J405	Strong	Altered Expression	[10]
Depression	DIS3XJ69	Strong	Biomarker	[11]
Ductal breast carcinoma in situ	DISLCJY7	Strong	Biomarker	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[12]
Exanthem	DISAFOQN	Strong	Biomarker	[13]
Generalized anxiety disorder	DISPSQCW	Strong	Biomarker	[11]
Glaucoma/ocular hypertension	DISLBXBY	Strong	Biomarker	[14]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[16]
Invasive breast carcinoma	DISANYTW	Strong	Biomarker	[8]
Laryngeal carcinoma	DISNHCIV	Strong	Biomarker	[17]
Lung cancer	DISCM4YA	Strong	Altered Expression	[2]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[2]
Lung neoplasm	DISVARNB	Strong	Altered Expression	[2]
Maxillary sinusitis	DISTJ9C9	Strong	Altered Expression	[18]
Melanoma	DIS1RRCY	Strong	Biomarker	[19]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Biomarker	[20]
Neoplasm	DISZKGEW	Strong	Altered Expression	[12]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[9]
Osteoarthritis	DIS05URM	Strong	Biomarker	[21]
Peeling skin syndrome 4	DISVMXR0	Strong	Autosomal recessive	[22]
Post-traumatic stress disorder	DISHL1EY	Strong	Biomarker	[13]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[2]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[23]
Glioblastoma multiforme	DISK8246	moderate	Biomarker	[24]
Obesity	DIS47Y1K	moderate	Altered Expression	[23]
Acral peeling skin syndrome	DIS7NJUZ	Supportive	Autosomal recessive	[25]
Exfoliative ichthyosis	DISH776B	Supportive	Autosomal recessive	[26]
Breast cancer	DIS7DPX1	Limited	Biomarker	[8]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[27]
Invasive ductal breast carcinoma	DIS43J58	Limited	Altered Expression	[27]
Matthew-Wood syndrome	DISA7HR7	Limited	Biomarker	[28]
Metastatic malignant neoplasm	DIS86UK6	Limited	Altered Expression	[27]
Pancreatic ductal carcinoma	DIS26F9Q	Limited	Altered Expression	[28]

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Cystatin-A (CSTA).	[29]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Cystatin-A (CSTA).	[30]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Cystatin-A (CSTA).	[31]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cystatin-A (CSTA).	[32]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Cystatin-A (CSTA).	[33]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Cystatin-A (CSTA).	[33]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Cystatin-A (CSTA).	[34]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Cystatin-A (CSTA).	[35]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Cystatin-A (CSTA).	[36]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Cystatin-A (CSTA).	[37]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Cystatin-A (CSTA).	[38]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Cystatin-A (CSTA).	[39]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Cystatin-A (CSTA).	[40]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Cystatin-A (CSTA).	[35]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Cystatin-A (CSTA).	[41]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol affects the expression of Cystatin-A (CSTA).	[33]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Cystatin-A (CSTA).	[42]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Cystatin-A (CSTA).	[43]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide decreases the expression of Cystatin-A (CSTA).	[44]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea affects the expression of Cystatin-A (CSTA).	[33]
Ampicillin	DMHWE7P	Approved	Ampicillin decreases the expression of Cystatin-A (CSTA).	[36]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Cystatin-A (CSTA).	[45]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene decreases the expression of Cystatin-A (CSTA).	[35]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Cystatin-A (CSTA).	[41]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Cystatin-A (CSTA).	[48]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Cystatin-A (CSTA).	[49]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Cystatin-A (CSTA).	[44]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride affects the expression of Cystatin-A (CSTA).	[33]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Cystatin-A (CSTA).	[36]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Cystatin-A (CSTA).	[46]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Cystatin-A (CSTA).	[47]

References

• [1] Proteomics of skin proteins in psoriasis: from discovery and verification in a mouse model to confirmation in humans.Mol Cell Proteomics. 2015 Jan;14(1):109-19. doi: 10.1074/mcp.M114.042242. Epub 2014 Oct 28.
• [2] Cystatin A suppresses tumor cell growth through inhibiting epithelial to mesenchymal transition in human lung cancer.Oncotarget. 2017 Dec 20;9(18):14084-14098. doi: 10.18632/oncotarget.23505. eCollection 2018 Mar 6.
• [3] Stefin A-functionalized liposomes as a system for cathepsins S and L-targeted drug delivery.Biochimie. 2019 Nov;166:94-102. doi: 10.1016/j.biochi.2019.05.018. Epub 2019 Jun 1.
• [4] Determining Factors for Stress Perception Assessed with the Perceived Stress Scale (PSS-4) in Spanish and Other European Samples.Front Psychol. 2018 Jan 26;9:37. doi: 10.3389/fpsyg.2018.00037. eCollection 2018.
• [5] A nonsynonymous substitution of cystatin A, a cysteine protease inhibitor of house dust mite protease, leads to decreased mRNA stability and shows a significant association with atopic dermatitis.Allergy. 2007 May;62(5):514-9. doi: 10.1111/j.1398-9995.2007.01350.x.
• [6] Characterization of prostate cancer in needle biopsy by cathepsin B, cell proliferation and DNA ploidy.Anticancer Res. 2010 Mar;30(3):719-25.
• [7] Cathepsin B and its inhibitor stefin A in brain tumors.Pflugers Arch. 2000;439(3 Suppl):R122-3.
• [8] Myoepithelial cell-specific expression of stefin A as a suppressor of early breast cancer invasion.J Pathol. 2017 Dec;243(4):496-509. doi: 10.1002/path.4990. Epub 2017 Oct 31.
• [9] Modulation of cystatin A expression in human airway epithelium related to genotype, smoking, COPD, and lung cancer.Cancer Res. 2011 Apr 1;71(7):2572-81. doi: 10.1158/0008-5472.CAN-10-2046. Epub 2011 Feb 16.
• [10] Endogenous Protease Inhibitors in Airway Epithelial Cells Contribute to Eosinophilic Chronic Rhinosinusitis.Am J Respir Crit Care Med. 2017 Mar 15;195(6):737-747. doi: 10.1164/rccm.201603-0529OC.
• [11] Real-World Evidence from the Integrative Medicine Primary Care Trial (IMPACT): Assessing Patient-Reported Outcomes at Baseline and 12-Month Follow-Up.Evid Based Complement Alternat Med. 2019 Jun 26;2019:8595409. doi: 10.1155/2019/8595409. eCollection 2019.
• [12] Clinicopathological significance of cystatin A expression in progression of esophageal squamous cell carcinoma.Medicine (Baltimore). 2018 Apr;97(15):e0357. doi: 10.1097/MD.0000000000010357.
• [13] Mental health effects following the eruption in Eyjafjallajkull volcano in Iceland: A population-based study.Scand J Public Health. 2019 Mar;47(2):251-259. doi: 10.1177/1403494817751327. Epub 2018 Jan 9.
• [14] Cystatin a, a potential common link for mutant myocilin causative glaucoma.PLoS One. 2012;7(5):e36301. doi: 10.1371/journal.pone.0036301. Epub 2012 May 15.
• [15] Cysteine proteinase inhibitor cystatin C in squamous cell carcinoma of the head and neck: relation to prognosis.Br J Cancer. 2004 May 17;90(10):1961-8. doi: 10.1038/sj.bjc.6601830.
• [16] Tissue Levels of Stefin A and Stefin B in Hepatocellular Carcinoma.Anat Rec (Hoboken). 2016 Apr;299(4):428-38. doi: 10.1002/ar.23311. Epub 2016 Feb 8.
• [17] Expression and clinical significance of cathepsin B and stefin A in laryngeal cancer.Oncol Rep. 2011 Oct;26(4):869-75. doi: 10.3892/or.2011.1344. Epub 2011 Jun 9.
• [18] Differential protein expression in the secretory fluids of maxillary sinusitis and maxillary retention cyst.Eur Arch Otorhinolaryngol. 2017 Jan;274(1):215-222. doi: 10.1007/s00405-016-4167-2. Epub 2016 Jul 15.
• [19] Contact of high-invasive, but not low-invasive, melanoma cells to native collagen I induces the release of mature cathepsin B.Int J Cancer. 2006 Jun 1;118(11):2735-43. doi: 10.1002/ijc.21700.
• [20] Identification of candidate nasopharyngeal carcinoma serum biomarkers by cancer cell secretome and tissue transcriptome analysis: potential usage of cystatin A for predicting nodal stage and poor prognosis.Proteomics. 2010 Jul;10(14):2644-60. doi: 10.1002/pmic.200900620.
• [21] Protein interaction and microRNA network analysis in osteoarthritis meniscal cells.Genet Mol Res. 2013 Mar 13;12(1):738-46. doi: 10.4238/2013.March.13.2.
• [22] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [23] Increased levels of the megakaryocyte and platelet expressed cysteine proteases stefin A and cystatin A prevent thrombosis.Sci Rep. 2019 Jul 3;9(1):9631. doi: 10.1038/s41598-019-45805-9.
• [24] The regulation of cysteine cathepsins and cystatins in human gliomas.Int J Cancer. 2012 Oct 15;131(8):1779-89. doi: 10.1002/ijc.27453. Epub 2012 Mar 9.
• [25] Acral peeling skin syndrome associated with a novel CSTA gene mutation. Clin Exp Dermatol. 2016 Jun;41(4):394-8. doi: 10.1111/ced.12777. Epub 2015 Dec 18.
• [26] Mutations in CSTA, encoding Cystatin A, underlie exfoliative ichthyosis and reveal a role for this protease inhibitor in cell-cell adhesion. Am J Hum Genet. 2011 Oct 7;89(4):564-71. doi: 10.1016/j.ajhg.2011.09.001. Epub 2011 Sep 22.
• [27] Primary tumour expression of the cysteine cathepsin inhibitor Stefin A inhibits distant metastasis in breast cancer.J Pathol. 2008 Feb;214(3):337-46. doi: 10.1002/path.2265.
• [28] Clinical features of cystatin A expression in patients with pancreatic ductal adenocarcinoma.Cancer Sci. 2017 Nov;108(11):2122-2129. doi: 10.1111/cas.13396. Epub 2017 Oct 8.
• [29] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [30] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [31] Pharmacogenomic analysis of acute promyelocytic leukemia cells highlights CYP26 cytochrome metabolism in differential all-trans retinoic acid sensitivity. Blood. 2007 May 15;109(10):4450-60.
• [32] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [33] Quantitative analysis of gene expression changes in response to genotoxic compounds. Toxicol In Vitro. 2017 Mar;39:15-28. doi: 10.1016/j.tiv.2016.11.004. Epub 2016 Nov 5.
• [34] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [35] Estrogen regulation in human breast cancer cells of new downstream gene targets involved in estrogen metabolism, cell proliferation and cell transformation. J Mol Endocrinol. 2004 Apr;32(2):397-414.
• [36] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [37] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [38] Gene expression profiling of rheumatoid arthritis synovial cells treated with antirheumatic drugs. J Biomol Screen. 2007 Apr;12(3):328-40. doi: 10.1177/1087057107299261. Epub 2007 Mar 22.
• [39] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [40] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [41] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [42] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [43] Effects of aspirin on metastasis-associated gene expression detected by cDNA microarray. Acta Pharmacol Sin. 2004 Oct;25(10):1327-33.
• [44] Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
• [45] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [46] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [47] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [48] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [49] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.