Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT331Y8V)

DOT Name Endothelial cell-specific molecule 1 (ESM1)
Synonyms ESM-1
Gene Name ESM1
Related Disease
Colon carcinoma ( )
Acute myocardial infarction ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Cardiovascular disease ( )
Clear cell renal carcinoma ( )
Colorectal carcinoma ( )
Colorectal neoplasm ( )
Coronary atherosclerosis ( )
Coronary heart disease ( )
Diabetic kidney disease ( )
Gastric cancer ( )
Glioma ( )
Head and neck cancer ( )
Head and neck carcinoma ( )
Head-neck squamous cell carcinoma ( )
Hepatitis ( )
Hepatitis A virus infection ( )
Kidney cancer ( )
Kidney neoplasm ( )
Liver cancer ( )
Liver cirrhosis ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Obstructive sleep apnea ( )
Oral cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
Renal carcinoma ( )
Squamous cell carcinoma ( )
Stomach cancer ( )
Triple negative breast cancer ( )
Bladder cancer ( )
Renal cell carcinoma ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Non-insulin dependent diabetes ( )
Vascular disease ( )
Advanced cancer ( )
B-cell neoplasm ( )
Ehlers-Danlos syndrome, spondylodysplastic type, 1 ( )
Erectile dysfunction ( )
Hepatocellular carcinoma ( )
leukaemia ( )
Leukemia ( )
Lung squamous cell carcinoma ( )
Type-1/2 diabetes ( )
UniProt ID
ESM1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00219
Sequence
MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAG
RGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSG
ICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKW
LNPR
Function Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions.
Tissue Specificity Expressed in lung, on the vascular capillary network within alveolar walls, and also at lower level in kidney.

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Colon carcinoma DISJYKUO Definitive Altered Expression [1]
Acute myocardial infarction DISE3HTG Strong Biomarker [2]
Arteriosclerosis DISK5QGC Strong Biomarker [3]
Atherosclerosis DISMN9J3 Strong Biomarker [3]
Cardiovascular disease DIS2IQDX Strong Biomarker [4]
Clear cell renal carcinoma DISBXRFJ Strong Biomarker [5]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [1]
Colorectal neoplasm DISR1UCN Strong Altered Expression [6]
Coronary atherosclerosis DISKNDYU Strong Altered Expression [4]
Coronary heart disease DIS5OIP1 Strong Altered Expression [4]
Diabetic kidney disease DISJMWEY Strong Altered Expression [7]
Gastric cancer DISXGOUK Strong Altered Expression [8]
Glioma DIS5RPEH Strong Altered Expression [9]
Head and neck cancer DISBPSQZ Strong Altered Expression [10]
Head and neck carcinoma DISOU1DS Strong Altered Expression [10]
Head-neck squamous cell carcinoma DISF7P24 Strong Altered Expression [11]
Hepatitis DISXXX35 Strong Altered Expression [12]
Hepatitis A virus infection DISUMFQV Strong Altered Expression [12]
Kidney cancer DISBIPKM Strong Altered Expression [13]
Kidney neoplasm DISBNZTN Strong Altered Expression [13]
Liver cancer DISDE4BI Strong Biomarker [14]
Liver cirrhosis DIS4G1GX Strong Altered Expression [12]
Neoplasm DISZKGEW Strong Altered Expression [15]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [16]
Obstructive sleep apnea DIS0SVD1 Strong Biomarker [17]
Oral cancer DISLD42D Strong Biomarker [18]
Prostate cancer DISF190Y Strong Biomarker [19]
Prostate carcinoma DISMJPLE Strong Biomarker [19]
Renal carcinoma DISER9XT Strong Altered Expression [13]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [18]
Stomach cancer DISKIJSX Strong Altered Expression [8]
Triple negative breast cancer DISAMG6N Strong Altered Expression [20]
Bladder cancer DISUHNM0 moderate Biomarker [21]
Renal cell carcinoma DISQZ2X8 moderate Biomarker [5]
Urinary bladder cancer DISDV4T7 moderate Biomarker [21]
Urinary bladder neoplasm DIS7HACE moderate Biomarker [21]
Non-insulin dependent diabetes DISK1O5Z Disputed Biomarker [22]
Vascular disease DISVS67S Disputed Altered Expression [22]
Advanced cancer DISAT1Z9 Limited Altered Expression [11]
B-cell neoplasm DISVY326 Limited Altered Expression [23]
Ehlers-Danlos syndrome, spondylodysplastic type, 1 DISJ607K Limited Biomarker [24]
Erectile dysfunction DISD8MTH Limited Altered Expression [25]
Hepatocellular carcinoma DIS0J828 Limited Biomarker [26]
leukaemia DISS7D1V Limited Biomarker [23]
Leukemia DISNAKFL Limited Biomarker [23]
Lung squamous cell carcinoma DISXPIBD Limited Genetic Variation [27]
Type-1/2 diabetes DISIUHAP Limited Altered Expression [28]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
15 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Endothelial cell-specific molecule 1 (ESM1). [29]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Endothelial cell-specific molecule 1 (ESM1). [30]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Endothelial cell-specific molecule 1 (ESM1). [31]
Arsenic DMTL2Y1 Approved Arsenic affects the expression of Endothelial cell-specific molecule 1 (ESM1). [32]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Endothelial cell-specific molecule 1 (ESM1). [33]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of Endothelial cell-specific molecule 1 (ESM1). [34]
Mifepristone DMGZQEF Approved Mifepristone increases the expression of Endothelial cell-specific molecule 1 (ESM1). [35]
Ampicillin DMHWE7P Approved Ampicillin decreases the expression of Endothelial cell-specific molecule 1 (ESM1). [33]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Endothelial cell-specific molecule 1 (ESM1). [36]
PD-0325901 DM27D4J Phase 2 PD-0325901 decreases the expression of Endothelial cell-specific molecule 1 (ESM1). [37]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Endothelial cell-specific molecule 1 (ESM1). [39]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Endothelial cell-specific molecule 1 (ESM1). [40]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Endothelial cell-specific molecule 1 (ESM1). [41]
OXYQUINOLINE DMZVS9Y Investigative OXYQUINOLINE decreases the expression of Endothelial cell-specific molecule 1 (ESM1). [33]
CHLORANIL DMCHGF1 Investigative CHLORANIL increases the expression of Endothelial cell-specific molecule 1 (ESM1). [42]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Endothelial cell-specific molecule 1 (ESM1). [38]
------------------------------------------------------------------------------------

References

1 Expression of endothelial cell-specific molecule-1 regulated by hypoxia inducible factor-1 in human colon carcinoma: impact of ESM-1 on prognosis and its correlation with clinicopathological features.Oncol Rep. 2012 Nov;28(5):1701-8. doi: 10.3892/or.2012.2012. Epub 2012 Sep 3.
2 Serum Endothelial Cell-Specific Molecule 1 (Endocan) Levels in Patients With Acute Myocardial Infarction and Its Clinical Significance.Angiology. 2017 Apr;68(4):354-359. doi: 10.1177/0003319716651349. Epub 2016 Sep 29.
3 Endocan Levels and Endothelial Dysfunction in Patients With Sarcoidosis.Angiology. 2018 Nov;69(10):878-883. doi: 10.1177/0003319718775283. Epub 2018 May 10.
4 Circulating ESM-1 levels are correlated with the presence of coronary artery disease in patients with obstructive sleep apnea.Respir Res. 2019 Aug 20;20(1):188. doi: 10.1186/s12931-019-1143-6.
5 Clinical validation of serum endocan (ESM-1) as a potential biomarker in patients with renal cell carcinoma.Oncotarget. 2017 Dec 10;9(1):662-667. doi: 10.18632/oncotarget.23087. eCollection 2018 Jan 2.
6 Correlation between expression and differentiation of endocan in colorectal cancer.World J Gastroenterol. 2008 Jul 28;14(28):4562-8. doi: 10.3748/wjg.14.4562.
7 Murine glomerular transcriptome links endothelial cell-specific molecule-1 deficiency with susceptibility to diabetic nephropathy.PLoS One. 2017 Sep 21;12(9):e0185250. doi: 10.1371/journal.pone.0185250. eCollection 2017.
8 Induction of cell differentiation and promotion of endocan gene expression in stomach cancer by melatonin.Mol Biol Rep. 2012 Mar;39(3):2843-9. doi: 10.1007/s11033-011-1043-4. Epub 2011 Jun 17.
9 HULC long noncoding RNA silencing suppresses angiogenesis by regulating ESM-1 via the PI3K/Akt/mTOR signaling pathway in human gliomas.Oncotarget. 2016 Mar 22;7(12):14429-40. doi: 10.18632/oncotarget.7418.
10 Functional analysis of ESM1 by siRNA knockdown in primary and metastatic head and neck cancer cells.J Oral Pathol Med. 2018 Jan;47(1):40-47. doi: 10.1111/jop.12648. Epub 2017 Oct 30.
11 Identification of ESM1 overexpressed in head and neck squamous cell carcinoma.Cancer Cell Int. 2019 May 2;19:118. doi: 10.1186/s12935-019-0833-y. eCollection 2019.
12 ESM-1 silencing decreased cell survival, migration, and invasion and modulated cell cycle progression in hepatocellular carcinoma.Amino Acids. 2011 Mar;40(3):1003-13. doi: 10.1007/s00726-010-0729-6. Epub 2010 Sep 7.
13 Endocan is a VEGF-A and PI3K regulated gene with increased expression in human renal cancer.Exp Cell Res. 2007 Apr 15;313(7):1285-94. doi: 10.1016/j.yexcr.2007.01.021. Epub 2007 Feb 6.
14 Discriminating between adaptive and carcinogenic liver hypertrophy in rat studies using logistic ridge regression analysis of toxicogenomic data: The mode of action and predictive models.Toxicol Appl Pharmacol. 2017 Mar 1;318:79-87. doi: 10.1016/j.taap.2017.01.006. Epub 2017 Jan 18.
15 Endothelial cell-specific molecule-1 as an invasiveness marker for pituitary null cell adenoma.BMC Endocr Disord. 2019 Aug 27;19(1):90. doi: 10.1186/s12902-019-0418-8.
16 Diagnostic and prognostic values of endothelial-cell-specific molecule-1 with malignant pleural effusions in patients with non-small cell lung cancer.Oncotarget. 2017 Jul 25;8(30):49217-49223. doi: 10.18632/oncotarget.17455.
17 ESM-1 promotes adhesion between monocytes and endothelial cells under intermittent hypoxia.J Cell Physiol. 2019 Feb;234(2):1512-1521. doi: 10.1002/jcp.27016. Epub 2018 Aug 24.
18 Plasma Levels of Endothelial Cell-Specific Molecule-1 as a Potential Biomarker of Oral Cancer Progression.Int J Med Sci. 2017 Sep 4;14(11):1094-1100. doi: 10.7150/ijms.20414. eCollection 2017.
19 Loss of endothelial cell-specific molecule 1 promotes the tumorigenicity and metastasis of prostate cancer cells through regulation of the TIMP-1/MMP-9 expression.Oncotarget. 2017 Feb 21;8(8):13886-13897. doi: 10.18632/oncotarget.14684.
20 Endocan as a prognostic biomarker of triple-negative breast cancer.Breast Cancer Res Treat. 2017 Jan;161(2):269-278. doi: 10.1007/s10549-016-4057-8. Epub 2016 Nov 25.
21 Exosomal MicroRNA-9-3p Secreted from BMSCs Downregulates ESM1 to Suppress the Development of Bladder Cancer.Mol Ther Nucleic Acids. 2019 Dec 6;18:787-800. doi: 10.1016/j.omtn.2019.09.023. Epub 2019 Oct 1.
22 Analysis of Serum Endothelial Cell-Specific Molecule 1 (Endocan) Level in Type 2 Diabetes Mellitus With Acute ST-Segment Elevation Myocardial Infarction and its Correlation: A Pilot Study.Angiology. 2017 Jan;68(1):74-78. doi: 10.1177/0003319716634581. Epub 2016 Feb 28.
23 Downregulation of ENDOCAN in myeloid leukemia cells inhibits proliferation and promotes apoptosis by suppressing nuclear factorB activity.Mol Med Rep. 2019 Apr;19(4):3247-3254. doi: 10.3892/mmr.2019.9969. Epub 2019 Feb 19.
24 Serum endocan levels in patients with stable COPD.Int J Chron Obstruct Pulmon Dis. 2018 Oct 15;13:3367-3372. doi: 10.2147/COPD.S182731. eCollection 2018.
25 Significance of serum endothelial cell specific molecule-1 (Endocan) level in patients with erectile dysfunction: a pilot study.Int J Impot Res. 2017 Jul;29(4):175-178. doi: 10.1038/ijir.2017.19. Epub 2017 Apr 20.
26 ESM1 as a Marker of Macrotrabecular-Massive Hepatocellular Carcinoma.Clin Cancer Res. 2019 Oct 1;25(19):5859-5865. doi: 10.1158/1078-0432.CCR-19-0859. Epub 2019 Jul 29.
27 Genome-wide association study of familial lung cancer.Carcinogenesis. 2018 Sep 21;39(9):1135-1140. doi: 10.1093/carcin/bgy080.
28 Glycated serum albumin stimulates expression of endothelial cell specific molecule-1 in human umbilical vein endothelial cells: Implication in diabetes mediated endothelial dysfunction.Diab Vasc Dis Res. 2015 Jul;12(4):290-7. doi: 10.1177/1479164115583192. Epub 2015 May 11.
29 In vivo biological effects of ATRA in the treatment of AML. Expert Opin Investig Drugs. 2008 Nov;17(11):1623-33. doi: 10.1517/13543784.17.11.1623.
30 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
31 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
32 Prenatal arsenic exposure and shifts in the newborn proteome: interindividual differences in tumor necrosis factor (TNF)-responsive signaling. Toxicol Sci. 2014 Jun;139(2):328-37. doi: 10.1093/toxsci/kfu053. Epub 2014 Mar 27.
33 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
34 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
35 Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
36 A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
37 PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
38 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
39 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
40 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
41 Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
42 Redox-active quinones induces genome-wide DNA methylation changes by an iron-mediated and Tet-dependent mechanism. Nucleic Acids Res. 2014 Feb;42(3):1593-605. doi: 10.1093/nar/gkt1090. Epub 2013 Nov 8.