Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4I143E)

DOT Name TATA box-binding protein-like 1 (TBPL1)
Synonyms TBP-like 1; 21 kDa TBP-like protein; Second TBP of unique DNA protein; STUD; TATA box-binding protein-related factor 2; TBP-related factor 2; TBP-like factor; TBP-related protein
Gene Name TBPL1
Related Disease
Asthma ( )
Glioblastoma multiforme ( )
Adult glioblastoma ( )
Adult T-cell leukemia/lymphoma ( )
Advanced cancer ( )
Alzheimer disease ( )
Analgesia ( )
Bladder cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Carcinoma ( )
Clear cell renal carcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal carcinoma ( )
Dowling-Degos disease ( )
Erythema multiforme ( )
Gastric cancer ( )
Hepatocellular carcinoma ( )
Leukemia ( )
Migraine disorder ( )
Mitochondrial myopathy ( )
Myocardial infarction ( )
Non-small-cell lung cancer ( )
Obesity ( )
Prostate neoplasm ( )
Renal cell carcinoma ( )
Schizophrenia ( )
Skin cancer ( )
T-cell leukaemia ( )
Type-1/2 diabetes ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Cardiovascular disease ( )
Ductal breast carcinoma in situ ( )
Focal segmental glomerulosclerosis ( )
Inflammatory bowel disease ( )
Leigh syndrome ( )
Metastatic malignant neoplasm ( )
Mucolipidosis type IV ( )
Neuroblastoma ( )
Osteoarthritis ( )
Polycystic kidney disease ( )
Prostate cancer ( )
Prostate carcinoma ( )
Squamous cell carcinoma ( )
Coronary heart disease ( )
Melanoma ( )
UniProt ID
TBPL1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00352
Sequence
MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATI
WSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEF
TKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFE
SRKEIL
Function
Part of a specialized transcription system that mediates the transcription of most ribosomal proteins through the 5'-TCT-3' motif which is a core promoter element at these genes. Seems to also mediate the transcription of NF1. Does not bind the TATA box.
Tissue Specificity Ubiquitously expressed, with highest levels in the testis and ovary.
KEGG Pathway
Basal transcription factors (hsa03022 )
Huntington disease (hsa05016 )
Spinocerebellar ataxia (hsa05017 )
Human papillomavirus infection (hsa05165 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Viral carcinogenesis (hsa05203 )

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Asthma DISW9QNS Definitive Altered Expression [1]
Glioblastoma multiforme DISK8246 Definitive Genetic Variation [2]
Adult glioblastoma DISVP4LU Strong Biomarker [3]
Adult T-cell leukemia/lymphoma DIS882XU Strong Biomarker [4]
Advanced cancer DISAT1Z9 Strong Biomarker [5]
Alzheimer disease DISF8S70 Strong Biomarker [6]
Analgesia DISK3TVI Strong Biomarker [7]
Bladder cancer DISUHNM0 Strong Biomarker [8]
Breast cancer DIS7DPX1 Strong Altered Expression [9]
Breast carcinoma DIS2UE88 Strong Biomarker [10]
Breast neoplasm DISNGJLM Strong Altered Expression [11]
Carcinoma DISH9F1N Strong Biomarker [12]
Clear cell renal carcinoma DISBXRFJ Strong Altered Expression [13]
Colon cancer DISVC52G Strong Altered Expression [14]
Colon carcinoma DISJYKUO Strong Altered Expression [14]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [15]
Dowling-Degos disease DISGTTEP Strong Biomarker [16]
Erythema multiforme DISKCLM1 Strong Genetic Variation [17]
Gastric cancer DISXGOUK Strong Biomarker [18]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [19]
Leukemia DISNAKFL Strong Biomarker [4]
Migraine disorder DISFCQTG Strong Altered Expression [20]
Mitochondrial myopathy DIS9SA7V Strong Genetic Variation [21]
Myocardial infarction DIS655KI Strong Biomarker [17]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [22]
Obesity DIS47Y1K Strong Biomarker [23]
Prostate neoplasm DISHDKGQ Strong Biomarker [24]
Renal cell carcinoma DISQZ2X8 Strong Altered Expression [13]
Schizophrenia DISSRV2N Strong Biomarker [25]
Skin cancer DISTM18U Strong Genetic Variation [26]
T-cell leukaemia DISJ6YIF Strong Biomarker [4]
Type-1/2 diabetes DISIUHAP Strong Biomarker [27]
Urinary bladder cancer DISDV4T7 Strong Biomarker [8]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [8]
Cardiovascular disease DIS2IQDX moderate Altered Expression [28]
Ductal breast carcinoma in situ DISLCJY7 moderate Biomarker [12]
Focal segmental glomerulosclerosis DISJNHH0 moderate Genetic Variation [29]
Inflammatory bowel disease DISGN23E moderate Genetic Variation [30]
Leigh syndrome DISWQU45 moderate Genetic Variation [31]
Metastatic malignant neoplasm DIS86UK6 moderate Altered Expression [32]
Mucolipidosis type IV DISWJY3U moderate Biomarker [33]
Neuroblastoma DISVZBI4 moderate Biomarker [34]
Osteoarthritis DIS05URM moderate Biomarker [35]
Polycystic kidney disease DISWS3UY moderate Genetic Variation [36]
Prostate cancer DISF190Y moderate Altered Expression [37]
Prostate carcinoma DISMJPLE moderate Altered Expression [37]
Squamous cell carcinoma DISQVIFL moderate Altered Expression [32]
Coronary heart disease DIS5OIP1 Limited Biomarker [38]
Melanoma DIS1RRCY Limited Biomarker [39]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of TATA box-binding protein-like 1 (TBPL1). [40]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of TATA box-binding protein-like 1 (TBPL1). [46]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of TATA box-binding protein-like 1 (TBPL1). [41]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of TATA box-binding protein-like 1 (TBPL1). [42]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate affects the expression of TATA box-binding protein-like 1 (TBPL1). [43]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of TATA box-binding protein-like 1 (TBPL1). [44]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of TATA box-binding protein-like 1 (TBPL1). [45]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of TATA box-binding protein-like 1 (TBPL1). [47]
Deguelin DMXT7WG Investigative Deguelin increases the expression of TATA box-binding protein-like 1 (TBPL1). [48]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Effect of San'ao decoction on aggravated asthma mice model induced by PM2.5 and TRPA1/TRPV1 expressions.J Ethnopharmacol. 2019 May 23;236:82-90. doi: 10.1016/j.jep.2019.02.043. Epub 2019 Mar 2.
2 Gene expressions of TRP channels in glioblastoma multiforme and relation with survival.Tumour Biol. 2015 Dec;36(12):9209-13. doi: 10.1007/s13277-015-3577-x. Epub 2015 Jun 19.
3 Molecular targeting of TRF2 suppresses the growth and tumorigenesis of glioblastoma stem cells.Glia. 2014 Oct;62(10):1687-98. doi: 10.1002/glia.22708. Epub 2014 Jun 7.
4 Telomere attrition and chromosome instability via downregulation of TRF2 contributes to arsenic trioxide-induced apoptosis of human T-Cell leukemia cell line molt-4 cells.Cancer Biol Ther. 2007 Aug;6(8):1186-92. doi: 10.4161/cbt.6.8.4381. Epub 2007 May 4.
5 Calcium Signaling and the Regulation of Chemosensitivity in Cancer Cells: Role of the Transient Receptor Potential Channels.Adv Exp Med Biol. 2020;1131:505-517. doi: 10.1007/978-3-030-12457-1_20.
6 Expression of telomere repeat binding factor 1 and TRF2 in Alzheimer's disease and correlation with clinical parameters.Neurol Res. 2019 Jun;41(6):504-509. doi: 10.1080/01616412.2019.1580456. Epub 2019 Feb 14.
7 Anti-nociceptive and anti-inflammatory effects of the ethanol extract of Arenga pinnata (Wurmb) Merr. fruit.J Ethnopharmacol. 2020 Feb 10;248:112349. doi: 10.1016/j.jep.2019.112349. Epub 2019 Nov 19.
8 Roles of tumor suppressor and telomere maintenance genes in cancer and aging--an epidemiological study.Carcinogenesis. 2005 Oct;26(10):1741-7. doi: 10.1093/carcin/bgi126. Epub 2005 May 19.
9 Molecular and cellular basis of mammary gland fibrosis and cancer risk.Int J Cancer. 2019 May 1;144(9):2239-2253. doi: 10.1002/ijc.32000. Epub 2018 Dec 28.
10 Do fasudil and Y-27632 affect the level of transient receptor potential (TRP) gene expressions in breast cancer cell lines?.Tumour Biol. 2014 Aug;35(8):8033-41. doi: 10.1007/s13277-014-1752-0. Epub 2014 May 18.
11 Coordinate regulation between expression levels of telomere-binding proteins and telomere length in breast carcinomas.Cancer Med. 2012 Oct;1(2):165-75. doi: 10.1002/cam4.14. Epub 2012 Jul 24.
12 Elevated TRF2 in advanced breast cancers with short telomeres.Breast Cancer Res Treat. 2011 Jun;127(3):623-30. doi: 10.1007/s10549-010-0988-7. Epub 2010 Jul 13.
13 Over-expression of telomere binding factors (TRF1 & TRF2) in renal cell carcinoma and their inhibition by using SiRNA induce apoptosis, reduce cell proliferation and migration invitro.PLoS One. 2015 Mar 2;10(3):e0115651. doi: 10.1371/journal.pone.0115651. eCollection 2015.
14 TRF2 inhibits a cell-extrinsic pathway through which natural killer cells eliminate cancer cells.Nat Cell Biol. 2013 Jul;15(7):818-28. doi: 10.1038/ncb2774. Epub 2013 Jun 23.
15 TRF2 positively regulates SULF2 expression increasing VEGF-A release and activity in tumor microenvironment.Nucleic Acids Res. 2019 Apr 23;47(7):3365-3382. doi: 10.1093/nar/gkz041.
16 Inflammaging in cervical and lumbar degenerated intervertebral discs: analysis of proinflammatory cytokine and TRP channel expression.Eur Spine J. 2018 Mar;27(3):564-577. doi: 10.1007/s00586-017-5360-8. Epub 2017 Dec 4.
17 SYNTAX Score and SYNTAX Score II Can Predict the Clinical Outcomes of Patients with Left Main and/or 3-Vessel Disease Undergoing Percutaneous Coronary Intervention in the Contemporary Cobalt-Chromium Everolimus-Eluting Stent Era.Korean Circ J. 2020 Jan;50(1):22-34. doi: 10.4070/kcj.2019.0097. Epub 2019 Sep 30.
18 Expression of telomere binding proteins in gastric cancer and correlation with clinicopathological parameters.Asia Pac J Clin Oncol. 2011 Dec;7(4):339-45. doi: 10.1111/j.1743-7563.2011.01437.x.
19 Nucleolar TRF2 attenuated nucleolus stress-induced HCC cell-cycle arrest by altering rRNA synthesis.Cell Death Dis. 2018 May 1;9(5):518. doi: 10.1038/s41419-018-0572-3.
20 TRP Channels as Potential Targets for Sex-Related Differences in Migraine Pain.Front Mol Biosci. 2018 Aug 14;5:73. doi: 10.3389/fmolb.2018.00073. eCollection 2018.
21 Mitochondrial myopathy associated with a novel 5522G>A mutation in the mitochondrial tRNA(Trp) gene.Eur J Hum Genet. 2013 Aug;21(8):871-5. doi: 10.1038/ejhg.2012.272. Epub 2012 Dec 12.
22 Modulation of telomere shelterin by TRF1 [corrected] and TRF2 interacts with telomerase to maintain the telomere length in non-small cell lung cancer.Lung Cancer. 2007 Dec;58(3):310-6. doi: 10.1016/j.lungcan.2007.06.019. Epub 2007 Aug 2.
23 TRPC1 regulates brown adipose tissue activity in a PPAR-dependent manner.Am J Physiol Endocrinol Metab. 2018 Nov 1;315(5):E825-E832. doi: 10.1152/ajpendo.00170.2017. Epub 2018 Jul 10.
24 Persistence of tumor-infiltrating CD8 T cells is tumor-dependent but antigen-independent.Cell Mol Immunol. 2011 Sep;8(5):415-23. doi: 10.1038/cmi.2011.18. Epub 2011 Jun 13.
25 TRP's: links to schizophrenia?.Biochim Biophys Acta. 2007 Aug;1772(8):968-77. doi: 10.1016/j.bbadis.2007.05.003. Epub 2007 May 21.
26 Genetic variants in telomere-maintaining genes and skin cancer risk.Hum Genet. 2011 Mar;129(3):247-53. doi: 10.1007/s00439-010-0921-5. Epub 2010 Nov 30.
27 One-year clinical outcome of biodegradable polymer sirolimus-eluting stent in all-comers population. Insight from the ULISSE registry (ULtimaster Italian multicenter all comerS Stent rEgistry).Int J Cardiol. 2018 Jun 1;260:36-41. doi: 10.1016/j.ijcard.2018.02.014.
28 Redox regulation of transient receptor potential channels in the endothelium.Microcirculation. 2017 Apr;24(3):10.1111/micc.12329. doi: 10.1111/micc.12329.
29 TRPC6 and FSGS: the latest TRP channelopathy.Biochim Biophys Acta. 2007 Aug;1772(8):859-68. doi: 10.1016/j.bbadis.2007.03.005. Epub 2007 Mar 20.
30 The Pivotal Role of TRP Channels in Homeostasis and Diseases throughout the Gastrointestinal Tract.Int J Mol Sci. 2019 Oct 24;20(21):5277. doi: 10.3390/ijms20215277.
31 Screening of mitochondrial mutations in Tunisian patients with mitochondrial disorders: an overview study.Mitochondrial DNA. 2013 Jun;24(3):163-78. doi: 10.3109/19401736.2012.748045. Epub 2013 Jan 9.
32 Telomere DNA damage signaling regulates cancer stem cell evolution, epithelial mesenchymal transition, and metastasis.Oncotarget. 2017 Sep 16;8(46):80139-80155. doi: 10.18632/oncotarget.20960. eCollection 2017 Oct 6.
33 Human TRPML1 channel structures in open and closed conformations.Nature. 2017 Oct 19;550(7676):366-370. doi: 10.1038/nature24036. Epub 2017 Oct 11.
34 TRF2 dysfunction elicits DNA damage responses associated with senescence in proliferating neural cells and differentiation of neurons.J Neurochem. 2006 Apr;97(2):567-81. doi: 10.1111/j.1471-4159.2006.03779.x. Epub 2006 Mar 15.
35 The role of transient receptor potential channels in joint diseases.Eur Cell Mater. 2017 Oct 10;34:180-201. doi: 10.22203/eCM.v034a12.
36 TRPP2: Ca2+-permeable cation channel and more.Cell Mol Biol (Noisy-le-grand). 2006 Dec 30;52(8):105-14.
37 Expression of Telomere Repeat Binding Factor 1 and TRF2 in Prostate Cancer and Correlation with Clinical Parameters.Biomed Res Int. 2017;2017:9764752. doi: 10.1155/2017/9764752. Epub 2017 Jul 20.
38 Long-term clinical outcomes after bioresorbable and permanent polymer drug-eluting stent implantation: final five-year results of the CENTURY II randomised clinical trial.EuroIntervention. 2018 Jun 8;14(3):e343-e351. doi: 10.4244/EIJ-D-18-00358.
39 Solid-in-Oil Peptide Nanocarriers for Transcutaneous Cancer Vaccine Delivery against Melanoma.Mol Pharm. 2018 Mar 5;15(3):955-961. doi: 10.1021/acs.molpharmaceut.7b00894. Epub 2018 Feb 15.
40 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
41 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
42 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
43 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
44 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
45 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
46 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
47 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
48 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.