Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5BN6VH)

• DOT Name: Breast cancer type 1 susceptibility protein (BRCA1)
• Synonyms: EC 2.3.2.27; RING finger protein 53; RING-type E3 ubiquitin transferase BRCA1
• Gene Name: BRCA1
• Related Disease:
  Breast-ovarian cancer, familial, susceptibility to, 1
  Fanconi anemia, complementation group S
  Acute monocytic leukemia
  Acute myelogenous leukaemia
  Breast adenocarcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Depression
  Ductal breast carcinoma in situ
  Endometrial carcinoma
  Fallopian tube cancer
  Fallopian tube carcinoma
  Familial pancreatic carcinoma
  Familial prostate carcinoma
  Fanconi anemia complementation group A
  Gastric cancer
  Hereditary neoplastic syndrome
  High blood pressure
  Isolated congenital microcephaly
  Myelodysplastic syndrome
  Pancreatic adenocarcinoma
  Pancreatic tumour
  Patent ductus arteriosus
  Peritoneal cancer
  Primary peritoneal carcinoma
  Serous cystadenocarcinoma
  Stomach cancer
  Pancreatic cancer, susceptibility to, 4
  Type-1/2 diabetes
  Fanconi's anemia
  Hereditary breast ovarian cancer syndrome
  Benign neoplasm
  Adenocarcinoma
  Chromosomal disorder
  Hypertrophic cardiomyopathy
  Invasive breast carcinoma
  Leukopenia
  Mouth disorder
  Pancreatic cancer
  Prostate neoplasm
  Schizophrenia
  Undifferentiated carcinoma
• UniProt ID: BRCA1_HUMAN
• PDB ID: 1JM7; 1JNX; 1N5O; 1OQA; 1T15; 1T29; 1T2U; 1T2V; 1Y98; 2ING; 3COJ; 3K0H; 3K0K; 3K15; 3K16; 3PXA; 3PXB; 3PXC; 3PXD; 3PXE; 4IFI; 4IGK; 4JLU; 4OFB; 4U4A; 4Y18; 4Y2G; 6G2I; 7JZV; 7LYB; 8GRQ
• EC Number: 2.3.2.27
• Pfam ID: PF00533 ; PF12820 ; PF00097
• Sequence:
  MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
  CPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKD
  EVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYI
  ELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQ
  PSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVE
  KAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPC
  SENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVD
  EYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTEN
  LIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTE
  QNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNI
  HNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPV
  RHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKE
  FVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQ
  ESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHS
  RETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVT
  FECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRG
  NETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIP
  STVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKL
  NAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSS
  HASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQ
  GYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENL
  LSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGS
  SKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSE
  DCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALE
  DLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSK
  CPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEG
  TPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTT
  DTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLI
  TEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDV
  VNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTL
  GTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPH
  SHY
• Function: E3 ubiquitin-protein ligase that specifically mediates the formation of 'Lys-6'-linked polyubiquitin chains and plays a central role in DNA repair by facilitating cellular responses to DNA damage. It is unclear whether it also mediates the formation of other types of polyubiquitin chains. The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Regulates centrosomal microtubule nucleation. Required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. Required for FANCD2 targeting to sites of DNA damage. Inhibits lipid synthesis by binding to inactive phosphorylated ACACA and preventing its dephosphorylation. Contributes to homologous recombination repair (HRR) via its direct interaction with PALB2, fine-tunes recombinational repair partly through its modulatory role in the PALB2-dependent loading of BRCA2-RAD51 repair machinery at DNA breaks. Component of the BRCA1-RBBP8 complex which regulates CHEK1 activation and controls cell cycle G2/M checkpoints on DNA damage via BRCA1-mediated ubiquitination of RBBP8. Acts as a transcriptional activator.
• Tissue Specificity: Isoform 1 and isoform 3 are widely expressed. Isoform 3 is reduced or absent in several breast and ovarian cancer cell lines.
• KEGG Pathway:
  Platinum drug resistance (hsa01524)
  Homologous recombi.tion (hsa03440)
  Fanconi anemia pathway (hsa03460)
  Ubiquitin mediated proteolysis (hsa04120)
  PI3K-Akt sig.ling pathway (hsa04151)
  MicroR.s in cancer (hsa05206)
  Breast cancer (hsa05224)
• Reactome Pathway:
  SUMOylation of DNA damage response and repair proteins (R-HSA-3108214)
  HDR through Single Strand Annealing (SSA) (R-HSA-5685938)
  HDR through Homologous Recombination (HRR) (R-HSA-5685942)
  Metalloprotease DUBs (R-HSA-5689901)
  Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA) (R-HSA-5693554)
  Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks (R-HSA-5693565)
  Resolution of D-loop Structures through Holliday Junction Intermediates (R-HSA-5693568)
  Nonhomologous End-Joining (NHEJ) (R-HSA-5693571)
  Homologous DNA Pairing and Strand Exchange (R-HSA-5693579)
  Processing of DNA double-strand break ends (R-HSA-5693607)
  Presynaptic phase of homologous DNA pairing and strand exchange (R-HSA-5693616)
  TP53 Regulates Transcription of DNA Repair Genes (R-HSA-6796648)
  Regulation of TP53 Activity through Phosphorylation (R-HSA-6804756)
  G2/M DNA damage checkpoint (R-HSA-69473)
  Neddylation (R-HSA-8951664)
  Transcriptional Regulation by E2F6 (R-HSA-8953750)
  Meiotic recombination (R-HSA-912446)
  Defective DNA double strand break response due to BRCA1 loss of function (R-HSA-9663199)
  Defective DNA double strand break response due to BARD1 loss of function (R-HSA-9699150)
  Defective homologous recombination repair (HRR) due to BRCA1 loss of function (R-HSA-9701192)
  Defective HDR through Homologous Recombination Repair (HRR) due to PALB2 loss of BRCA1 binding function (R-HSA-9704331)
  Defective HDR through Homologous Recombination Repair (HRR) due to PALB2 loss of BRCA2/RAD51/RAD51C binding function (R-HSA-9704646)
  Impaired BRCA2 binding to RAD51 (R-HSA-9709570)
  Impaired BRCA2 binding to PALB2 (R-HSA-9709603)
  KEAP1-NFE2L2 pathway (R-HSA-9755511)
  Meiotic synapsis (R-HSA-1221632)

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast-ovarian cancer, familial, susceptibility to, 1	DIS75QET	Definitive	Autosomal dominant	[1]
Fanconi anemia, complementation group S	DIS9UW4J	Definitive	Autosomal recessive	[1]
Acute monocytic leukemia	DIS28NEL	Strong	Biomarker	[2]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[2]
Breast adenocarcinoma	DISMPHJ0	Strong	Biomarker	[3]
Colon cancer	DISVC52G	Strong	Biomarker	[4]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[4]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[5]
Depression	DIS3XJ69	Strong	Biomarker	[6]
Ductal breast carcinoma in situ	DISLCJY7	Strong	Genetic Variation	[7]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[8]
Fallopian tube cancer	DISXHWCS	Strong	Genetic Variation	[9]
Fallopian tube carcinoma	DIST7A80	Strong	Genetic Variation	[9]
Familial pancreatic carcinoma	DIS1XROR	Strong	Genetic Variation	[10]
Familial prostate carcinoma	DISL9KNO	Strong	Genetic Variation	[11]
Fanconi anemia complementation group A	DIS8PZLI	Strong	Autosomal recessive	[12]
Gastric cancer	DISXGOUK	Strong	Biomarker	[13]
Hereditary neoplastic syndrome	DISGXLG5	Strong	Biomarker	[14]
High blood pressure	DISY2OHH	Strong	Biomarker	[15]
Isolated congenital microcephaly	DISUXHZ6	Strong	Biomarker	[16]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[2]
Pancreatic adenocarcinoma	DISKHX7S	Strong	Biomarker	[17]
Pancreatic tumour	DIS3U0LK	Strong	Biomarker	[18]
Patent ductus arteriosus	DIS9P8YS	Strong	Altered Expression	[19]
Peritoneal cancer	DISYX23I	Strong	Genetic Variation	[20]
Primary peritoneal carcinoma	DISKYEDV	Strong	Genetic Variation	[21]
Serous cystadenocarcinoma	DISVK716	Strong	Genetic Variation	[22]
Stomach cancer	DISKIJSX	Strong	Biomarker	[13]
Pancreatic cancer, susceptibility to, 4	DIS0D4QQ	Moderate	Autosomal dominant	[23]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[24]
Fanconi's anemia	DISGW6Q8	Supportive	Autosomal recessive	[25]
Hereditary breast ovarian cancer syndrome	DISWDUGU	Supportive	Autosomal dominant	[26]
Benign neoplasm	DISDUXAD	Disputed	Biomarker	[27]
Adenocarcinoma	DIS3IHTY	Limited	Genetic Variation	[28]
Chromosomal disorder	DISM5BB5	Limited	Altered Expression	[29]
Hypertrophic cardiomyopathy	DISQG2AI	Limited	Biomarker	[30]
Invasive breast carcinoma	DISANYTW	Limited	Genetic Variation	[31]
Leukopenia	DISJMBMM	Limited	Genetic Variation	[32]
Mouth disorder	DISX82BI	Limited	Biomarker	[33]
Pancreatic cancer	DISJC981	Limited	Genetic Variation	[34]
Prostate neoplasm	DISHDKGQ	Limited	Genetic Variation	[35]
Schizophrenia	DISSRV2N	Limited	Biomarker	[36]
Undifferentiated carcinoma	DISIAZST	Limited	Biomarker	[37]

This DOT Affected the Drug Response of 7 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitomycin	DMH0ZJE	Approved	Breast cancer type 1 susceptibility protein (BRCA1) increases the response to substance of Mitomycin.	[93]
Olaparib	DM8QB1D	Approved	Breast cancer type 1 susceptibility protein (BRCA1) affects the response to substance of Olaparib.	[94]
Talazoparib	DM1KS78	Approved	Breast cancer type 1 susceptibility protein (BRCA1) increases the response to substance of Talazoparib.	[95]
Carfilzomib	DM48K0X	Approved	Breast cancer type 1 susceptibility protein (BRCA1) increases the response to substance of Carfilzomib.	[96]
Camptothecin	DM6CHNJ	Phase 3	Breast cancer type 1 susceptibility protein (BRCA1) decreases the response to substance of Camptothecin.	[97]
BSI-201	DMM0VO3	Phase 3	Breast cancer type 1 susceptibility protein (BRCA1) decreases the response to substance of BSI-201.	[98]
Paraquat	DMR8O3X	Investigative	Breast cancer type 1 susceptibility protein (BRCA1) decreases the response to substance of Paraquat.	[99]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Breast cancer type 1 susceptibility protein (BRCA1).	[38]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Breast cancer type 1 susceptibility protein (BRCA1).	[46]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Breast cancer type 1 susceptibility protein (BRCA1).	[77]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Breast cancer type 1 susceptibility protein (BRCA1).	[79]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Breast cancer type 1 susceptibility protein (BRCA1).	[81]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Breast cancer type 1 susceptibility protein (BRCA1).	[79]

56 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[39]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[41]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[42]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate affects the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[43]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[44]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[45]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[47]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[48]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[49]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[50]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[51]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[50]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[52]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[53]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[55]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[56]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[57]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[58]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[59]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[60]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[61]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[62]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[56]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[56]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[63]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[64]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[65]
Sulindac	DM2QHZU	Approved	Sulindac decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[66]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[67]
Acocantherin	DM7JT24	Approved	Acocantherin decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[68]
Lindane	DMB8CNL	Approved	Lindane increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[57]
Furazolidone	DM3P6V7	Approved	Furazolidone increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[69]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[70]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[71]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[40]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[72]
I3C	DMIGFOR	Phase 3	I3C increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[73]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[73]
INCB054329	DM7TZL0	Phase 1/2	INCB054329 decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[74]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[75]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[76]
Arecoline	DMFJZK3	Phase 1	Arecoline decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[33]
SCH 727965	DMCJLD1	Discontinued in Phase 3	SCH 727965 decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[80]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[73]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[82]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[83]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[84]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[85]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[86]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[87]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[88]
OXYBENZONE	DMMZYX6	Investigative	OXYBENZONE increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[89]
Daidzein	DMRFTJX	Investigative	Daidzein increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[90]
Fenthion	DMKEG49	Investigative	Fenthion decreases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[91]
toxaphene	DM4R657	Investigative	toxaphene increases the expression of Breast cancer type 1 susceptibility protein (BRCA1).	[92]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Decitabine	DMQL8XJ	Approved	Decitabine affects the localization of Breast cancer type 1 susceptibility protein (BRCA1).	[54]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Germline Genetic Predisposition to Hematologic Malignancy.J Clin Oncol. 2017 Mar 20;35(9):1018-1028. doi: 10.1200/JCO.2016.70.8644. Epub 2017 Feb 13.
• [3] Multicentric glioblastoma multiforme in a patient with BRCA-1 invasive breast cancer.Breast J. 2006 Sep-Oct;12(5):470-4. doi: 10.1111/j.1075-122X.2006.00307.x.
• [4] Colorectal cancer-derived extracellular vesicles induce transformation of fibroblasts into colon carcinoma cells.J Exp Clin Cancer Res. 2019 Jun 14;38(1):257. doi: 10.1186/s13046-019-1248-2.
• [5] Detection of Pathogenic Germline Variants Among Patients With Advanced Colorectal Cancer Undergoing Tumor Genomic Profiling for Precision Medicine.Dis Colon Rectum. 2019 Apr;62(4):429-437. doi: 10.1097/DCR.0000000000001322.
• [6] Quality of Life and Psychological State in Chinese Breast Cancer Patients Who Received BRCA1/2 Genetic Testing.PLoS One. 2016 Jul 18;11(7):e0158531. doi: 10.1371/journal.pone.0158531. eCollection 2016.
• [7] BRCA1/BRCA2 mutations in Japanese women with ductal carcinoma in situ.Mol Genet Genomic Med. 2019 Mar;7(3):e493. doi: 10.1002/mgg3.493. Epub 2019 Jan 16.
• [8] Preventing Ovarian Cancer in High-risk Women: One Surgery at a Time.Clin Obstet Gynecol. 2020 Mar;63(1):64-73. doi: 10.1097/GRF.0000000000000499.
• [9] The lack of clinical value of peritoneal washing cytology in high risk patients undergoing risk-reducing salpingo-oophorectomy: a retrospective study and review.BMC Cancer. 2016 Jan 14;16:18. doi: 10.1186/s12885-015-2011-5.
• [10] BRCA1, BRCA2, PALB2, and CDKN2A mutations in familial pancreatic cancer: a PACGENE study.Genet Med. 2015 Jul;17(7):569-77. doi: 10.1038/gim.2014.153. Epub 2014 Nov 20.
• [11] Urological cancer related to familial syndromes.Int Braz J Urol. 2017 Mar-Apr;43(2):192-201. doi: 10.1590/S1677-5538.IBJU.2016.0125.
• [12] Fanconi Anaemia, Childhood Cancer and the BRCA Genes. Genes (Basel). 2021 Sep 27;12(10):1520. doi: 10.3390/genes12101520.
• [13] RBBP8/CtIP suppresses P21 expression by interacting with CtBP and BRCA1 in gastric cancer.Oncogene. 2020 Feb;39(6):1273-1289. doi: 10.1038/s41388-019-1060-7. Epub 2019 Oct 21.
• [14] Next-generation sequencing of BRCA1 and BRCA2 genes for rapid detection of germline mutations in hereditary breast/ovarian cancer.PeerJ. 2019 Apr 22;7:e6661. doi: 10.7717/peerj.6661. eCollection 2019.
• [15] BRCA1 shields vascular smooth muscle cells from oxidative stress.J Thorac Cardiovasc Surg. 2014 Jun;147(6):1946-55, 1955.e1. doi: 10.1016/j.jtcvs.2013.09.060. Epub 2013 Nov 13.
• [16] BRIT1/MCPH1 is a DNA damage responsive protein that regulates the Brca1-Chk1 pathway, implicating checkpoint dysfunction in microcephaly.Proc Natl Acad Sci U S A. 2005 Oct 18;102(42):15105-9. doi: 10.1073/pnas.0507722102. Epub 2005 Oct 10.
• [17] Germline cancer susceptibility gene variants, somatic second hits, and survival outcomes in patients with resected pancreatic cancer.Genet Med. 2019 Jan;21(1):213-223. doi: 10.1038/s41436-018-0009-5. Epub 2018 Jul 2.
• [18] Common variation at 2p13.3, 3q29, 7p13 and 17q25.1 associated with susceptibility to pancreatic cancer.Nat Genet. 2015 Aug;47(8):911-6. doi: 10.1038/ng.3341. Epub 2015 Jun 22.
• [19] BRCA1 negatively regulates the cancer-associated aromatase promoters I.3 and II in breast adipose fibroblasts and malignant epithelial cells.J Clin Endocrinol Metab. 2006 Nov;91(11):4514-9. doi: 10.1210/jc.2006-1364. Epub 2006 Aug 29.
• [20] Risk Assessment, Genetic Counseling, and Genetic Testing for BRCA-Related Cancer: US Preventive Services Task Force Recommendation Statement.JAMA. 2019 Aug 20;322(7):652-665. doi: 10.1001/jama.2019.10987.
• [21] Evaluation of Transvaginal Ultrasound plus CA-125 Measurement and Prophylactic Salpingo-Oophorectomy in Women at Different Risk Levels of Ovarian Cancer: The Modena Study Group Cohort Study.Oncology. 2017;93(6):377-386. doi: 10.1159/000479155. Epub 2017 Aug 26.
• [22] Retrospective study of a 16year cohort of BRCA1 and BRCA2 carriers presenting for RRSO: Prevalence of invasive and in-situ carcinoma, with follow-up.Gynecol Oncol. 2019 May;153(2):326-334. doi: 10.1016/j.ygyno.2019.03.003. Epub 2019 Mar 18.
• [23] Current Approaches to Pancreatic Cancer Screening. Am J Pathol. 2019 Jan;189(1):22-35. doi: 10.1016/j.ajpath.2018.09.013.
• [24] Scoring System to Optimize Pioglitazone Therapy After Stroke Based on Fracture Risk.Stroke. 2019 Jan;50(1):95-100. doi: 10.1161/STROKEAHA.118.022745. Epub 2018 Dec 10.
• [25] Homozygous loss of function BRCA1 variant causing a Fanconi-anemia-like phenotype, a clinical report and review of previous patients. Eur J Med Genet. 2018 Mar;61(3):130-133. doi: 10.1016/j.ejmg.2017.11.003. Epub 2017 Nov 10.
• [26] Hereditary ovarian cancer. Hum Pathol. 2005 Aug;36(8):861-70. doi: 10.1016/j.humpath.2005.06.006.
• [27] Expression of BRCA1 protein in benign, borderline, and malignant epithelial ovarian neoplasms and its relationship to methylation and allelic loss of the BRCA1 gene.J Pathol. 2004 Feb;202(2):215-23. doi: 10.1002/path.1507.
• [28] A targeted analysis identifies a high frequency of BRCA1 and BRCA2 mutation carriers in women with ovarian cancer from a founder population.J Ovarian Res. 2015 Mar 27;8:1. doi: 10.1186/s13048-015-0124-8.
• [29] DYNLL1 binds to MRE11 to limit DNA end resection in BRCA1-deficient cells.Nature. 2018 Nov;563(7732):522-526. doi: 10.1038/s41586-018-0670-5. Epub 2018 Oct 31.
• [30] Experiences of predictive testing in young people at risk of Huntington's disease, familial cardiomyopathy or hereditary breast and ovarian cancer.Eur J Hum Genet. 2014 Mar;22(3):396-401. doi: 10.1038/ejhg.2013.143. Epub 2013 Jul 17.
• [31] Risk of ipsilateral breast tumor recurrence in primary invasive breast cancer following breast-conserving surgery with BRCA1 and BRCA2 mutation in China.Breast Cancer Res Treat. 2019 Jun;175(3):749-754. doi: 10.1007/s10549-019-05199-8. Epub 2019 Mar 20.
• [32] BRCA1/BRCA2 germline mutations and chemotherapy-related hematological toxicity in breast cancer patients.Breast Cancer Res Treat. 2019 Apr;174(3):775-783. doi: 10.1007/s10549-018-05127-2. Epub 2019 Jan 11.
• [33] Characterization of arecoline-induced effects on cytotoxicity in normal human gingival fibroblasts by global gene expression profiling. Toxicol Sci. 2007 Nov;100(1):66-74.
• [34] Genotype-phenotype correlation in BRCA1/2 mutation-associated pancreatic cancer.Br J Cancer. 2020 Feb;122(3):293-294. doi: 10.1038/s41416-019-0645-9. Epub 2019 Dec 2.
• [35] Germline BRCA mutations are associated with higher risk of nodal involvement, distant metastasis, and poor survival outcomes in prostate cancer.J Clin Oncol. 2013 May 10;31(14):1748-57. doi: 10.1200/JCO.2012.43.1882. Epub 2013 Apr 8.
• [36] Cell cycle checkpoint abnormalities during dementia: A plausible association with the loss of protection against oxidative stress in Alzheimer's disease [corrected].PLoS One. 2013 Jul 5;8(7):e68361. doi: 10.1371/journal.pone.0068361. Print 2013.
• [37] Ovarian carcinomas with genetic and epigenetic BRCA1 loss have distinct molecular abnormalities.BMC Cancer. 2008 Jan 22;8:17. doi: 10.1186/1471-2407-8-17.
• [38] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [39] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [40] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [41] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [42] Coordinate alterations in the expression of BRCA1, BRCA2, p300, and Rad51 in response to genotoxic and other stresses in human prostate cancer cells. Prostate. 1999 Jun 15;40(1):37-49. doi: 10.1002/(sici)1097-0045(19990615)40:1<37::aid-pros5>3.0.co;2-p.
• [43] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [44] Estrogen receptor beta decreases survival of p53-defective cancer cells after DNA damage by impairing G?/M checkpoint signaling. Breast Cancer Res Treat. 2011 Jun;127(2):417-27. doi: 10.1007/s10549-010-1011-z. Epub 2010 Jul 10.
• [45] Molecular mechanism of action of bisphenol and bisphenol A mediated by oestrogen receptor alpha in growth and apoptosis of breast cancer cells. Br J Pharmacol. 2013 May;169(1):167-78.
• [46] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [47] Quercetin and Its Fermented Extract as a Potential Inhibitor of Bisphenol A-Exposed HT-29 Colon Cancer Cells' Viability. Int J Mol Sci. 2023 Mar 15;24(6):5604. doi: 10.3390/ijms24065604.
• [48] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [49] Pro-oxidant induced DNA damage in human lymphoblastoid cells: homeostatic mechanisms of genotoxic tolerance. Toxicol Sci. 2012 Aug;128(2):387-97. doi: 10.1093/toxsci/kfs152. Epub 2012 Apr 26.
• [50] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [51] The effect of the histone deacetylase inhibitor M344 on BRCA1 expression in breast and ovarian cancer cells. Cancer Cell Int. 2011 Aug 19;11(1):29. doi: 10.1186/1475-2867-11-29.
• [52] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [53] Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
• [54] DNA methylation inhibitor 5-Aza-2'-deoxycytidine induces reversible genome-wide DNA damage that is distinctly influenced by DNA methyltransferases 1 and 3B. Mol Cell Biol. 2008 Jan;28(2):752-71. doi: 10.1128/MCB.01799-07. Epub 2007 Nov 8.
• [55] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [56] Development and applications of a real-time quantitative RT-PCR method (QRT-PCR) for BRCA1 mRNA. Clin Biochem. 2005 Jan;38(1):50-7. doi: 10.1016/j.clinbiochem.2004.09.012.
• [57] Cross-talk between non-genomic and genomic signalling pathways--distinct effect profiles of environmental estrogens. Toxicol Appl Pharmacol. 2010 Jun 1;245(2):160-70. doi: 10.1016/j.taap.2010.02.015. Epub 2010 Mar 4.
• [58] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [59] Bortezomib-induced "BRCAness" sensitizes multiple myeloma cells to PARP inhibitors. Blood. 2011 Dec 8;118(24):6368-79. doi: 10.1182/blood-2011-06-363911. Epub 2011 Sep 13.
• [60] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [61] miR-7-5p overexpression suppresses cell proliferation and promotes apoptosis through inhibiting the ability of DNA damage repair of PARP-1 and BRCA1 in TK6 cells exposed to hydroquinone. Chem Biol Interact. 2018 Mar 1;283:84-90. doi: 10.1016/j.cbi.2018.01.019. Epub 2018 Feb 5.
• [62] Lunasin, a novel seed peptide, sensitizes human breast cancer MDA-MB-231 cells to aspirin-arrested cell cycle and induced apoptosis. Chem Biol Interact. 2010 Jul 30;186(2):127-34. doi: 10.1016/j.cbi.2010.04.027. Epub 2010 May 21.
• [63] Effects of tobacco compounds on gene expression in fetal lung fibroblasts. Environ Toxicol. 2008 Aug;23(4):423-34.
• [64] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [65] A fine-needle aspirate-based vulnerability assay identifies polo-like kinase 1 as a mediator of gemcitabine resistance in pancreatic cancer. Mol Cancer Ther. 2010 Feb;9(2):311-8. doi: 10.1158/1535-7163.MCT-09-0693. Epub 2010 Jan 26.
• [66] Differential gene expression of sulindac-treated human breast epithelial cells. Int J Oncol. 2005 Dec;27(6):1727-36.
• [67] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [68] Ouabain induces apoptotic cell death in human prostate DU 145 cancer cells through DNA damage and TRAIL pathways. Environ Toxicol. 2019 Dec;34(12):1329-1339. doi: 10.1002/tox.22834. Epub 2019 Aug 21.
• [69] Involvement of the activation of Nrf2/HO-1, p38 MAPK signaling pathways and endoplasmic reticulum stress in furazolidone induced cytotoxicity and S phase arrest in human hepatocyte L02 cells: modulation of curcumin. Toxicol Mech Methods. 2017 Mar;27(3):165-172. doi: 10.1080/15376516.2016.1273424. Epub 2017 Jan 8.
• [70] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [71] Effects of resveratrol on the expression of a panel of genes interacting with the BRCA1 oncosuppressor in human breast cell lines. Clin Chim Acta. 2004 Jun;344(1-2):115-21. doi: 10.1016/j.cccn.2004.02.024.
• [72] Mechanisms of DNA methyltransferase-inhibitor interactions: Procyanidin B2 shows new promise for therapeutic intervention of cancer. Chem Biol Interact. 2015 May 25;233:122-38. doi: 10.1016/j.cbi.2015.03.022. Epub 2015 Mar 31.
• [73] BRCA1 and BRCA2 as molecular targets for phytochemicals indole-3-carbinol and genistein in breast and prostate cancer cells. Br J Cancer. 2006 Feb 13;94(3):407-26. doi: 10.1038/sj.bjc.6602935.
• [74] The BET inhibitor INCB054329 reduces homologous recombination efficiency and augments PARP inhibitor activity in ovarian cancer. Gynecol Oncol. 2018 Jun;149(3):575-584. doi: 10.1016/j.ygyno.2018.03.049. Epub 2018 Mar 20.
• [75] Activation of the aromatic hydrocarbon receptor pathway is not sufficient for transcriptional repression of BRCA-1: requirements for metabolism of benzo[a]pyrene to 7r,8t-dihydroxy-9t,10-epoxy-7,8,9,10-tetrahydrobenzo[a]pyrene. Cancer Res. 2002 Jan 1;62(1):113-21.
• [76] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [77] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [78] Characterization of arecoline-induced effects on cytotoxicity in normal human gingival fibroblasts by global gene expression profiling. Toxicol Sci. 2007 Nov;100(1):66-74.
• [79] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [80] CDK12 Inhibition Reverses De Novo and Acquired PARP Inhibitor Resistance in BRCA Wild-Type and Mutated Models of Triple-Negative Breast Cancer. Cell Rep. 2016 Nov 22;17(9):2367-2381. doi: 10.1016/j.celrep.2016.10.077.
• [81] Effects of bisphenol A exposure on the proliferation and senescence of normal human mammary epithelial cells. Cancer Biol Ther. 2012 Mar;13(5):296-306. doi: 10.4161/cbt.18942. Epub 2012 Mar 1.
• [82] MCM-2 is a therapeutic target of Trichostatin A in colon cancer cells. Toxicol Lett. 2013 Jul 31;221(1):23-30. doi: 10.1016/j.toxlet.2013.05.643. Epub 2013 Jun 13.
• [83] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [84] Induction of DNA damage by deguelin is mediated through reducing DNA repair genes in human non-small cell lung cancer NCI-H460 cells. Oncol Rep. 2012 Apr;27(4):959-64. doi: 10.3892/or.2012.1622. Epub 2012 Jan 4.
• [85] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [86] Nickel induces transcriptional down-regulation of DNA repair pathways in tumorigenic and non-tumorigenic lung cells. Carcinogenesis. 2017 Jun 1;38(6):627-637.
• [87] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [88] Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.
• [89] Chromatin modifiers: A new class of pollutants with potential epigenetic effects revealed by in vitro assays and transcriptomic analyses. Toxicology. 2023 Jan 15;484:153413. doi: 10.1016/j.tox.2022.153413. Epub 2022 Dec 26.
• [90] Phytoestrogens activate estrogen receptor beta1 and estrogenic responses in human breast and bone cancer cell lines. Mol Nutr Food Res. 2007 Feb;51(2):171-7. doi: 10.1002/mnfr.200600091.
• [91] The cytotoxicity and genotoxicity of single and combined fenthion and terbufos treatments in human liver cells and zebrafish embryos. Sci Total Environ. 2021 Mar 1;758:143597. doi: 10.1016/j.scitotenv.2020.143597. Epub 2020 Nov 10.
• [92] Inhibition of E2-induced expression of BRCA1 by persistent organochlorines. Breast Cancer Res. 2002;4(6):R12. doi: 10.1186/bcr461. Epub 2002 Jul 24.
• [93] Mutation of the BRCA1 SQ-cluster results in aberrant mitosis, reduced homologous recombination, and a compensatory increase in non-homologous end joining. Oncotarget. 2015 Sep 29;6(29):27674-87. doi: 10.18632/oncotarget.4876.
• [94] Identification of human triple-negative breast cancer subtypes and preclinical models for selection of targeted therapies. J Clin Invest. 2011 Jul;121(7):2750-67. doi: 10.1172/JCI45014.
• [95] BMN 673 (talazoparib): A potent PARP inhibitor for triple negative breast cancer with different genetic profile. J Biochem Mol Toxicol. 2019 May;33(5):e22286. doi: 10.1002/jbt.22286. Epub 2019 Jan 23.
• [96] Suppression of BRCA1 sensitizes cells to proteasome inhibitors. Cell Death Dis. 2014 Dec 18;5(12):e1580. doi: 10.1038/cddis.2014.537.
• [97] ATR inhibitors VE-821 and VX-970 sensitize cancer cells to topoisomerase i inhibitors by disabling DNA replication initiation and fork elongation responses. Cancer Res. 2014 Dec 1;74(23):6968-79.
• [98] Response of subtype-specific human breast cancer-derived cells to poly(ADP-ribose) polymerase and checkpoint kinase 1 inhibition. Cancer Sci. 2011 Oct;102(10):1882-8. doi: 10.1111/j.1349-7006.2011.02016.x. Epub 2011 Jul 21.
• [99] BRCA1 induces antioxidant gene expression and resistance to oxidative stress. Cancer Res. 2004 Nov 1;64(21):7893-909. doi: 10.1158/0008-5472.CAN-04-1119.