Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6YGTVX)

• DOT Name: Ladinin-1 (LAD1)
• Synonyms: Lad-1; Linear IgA disease antigen; LADA
• Gene Name: LAD1
• Related Disease:
  Arteriosclerosis
  Atherosclerosis
  Autoimmune disease
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Bullous pemphigoid
  Cardiac failure
  Congenital disorder of glycosylation
  Congestive heart failure
  Coronary ischemia
  Depression
  Diabetic kidney disease
  Graves disease
  Hyperlipidemia
  Inborn error of immunity
  Intellectual disability
  Junctional epidermolysis bullosa
  Leukocyte adhesion deficiency
  Leukocyte adhesion deficiency type II
  Lung adenocarcinoma
  Mast cell leukaemia
  Multiple sclerosis
  Myocardial infarction
  Neoplasm
  Non-insulin dependent diabetes
  Peripheral vascular disease
  Pyoderma gangrenosum
  Skin disease
  Stroke
  Type-1 diabetes
  Type-1/2 diabetes
  Varicose veins
  Vascular disease
  Laryngeal carcinoma
  Metastatic malignant neoplasm
  Periodontitis
  Epidermolysis bullosa
  Coronary heart disease
  Cutaneous mastocytosis
  Dementia
  Frontotemporal dementia
  Glanzmann thrombasthenia
  Leukocyte adhesion deficiency type 1
  Lewy body dementia
  Parkinson disease
  Pick disease
• UniProt ID: LAD1_HUMAN
• Sequence:
  MAVSRKDWSALSSLARQRTLEDEEEQERERRRRHRNLSSTTDDEAPRLSQNGDRQASASE
  RLPSVEEAEVPKPLPPASKDEDEDIQSILRTRQERRQRRQVVEAAQAPIQERLEAEEGRN
  SLSPVQATQKPLVSKKELEIPPRRRLSREQRGPWALEEESLVGREPEERKKGVPEKSPVL
  EKSSMPKKTAPEKSLVSDKTSISEKVLASEKTSLSEKIAVSEKRNSSEKKSVLEKTSVSE
  KSLAPGMALGSGRRLVSEKASIFEKALASEKSPTADAKPAPKRATASEQPLAQEPPASGG
  SPATTKEQRGRALPGKNLPSLAKQGASDPPTVASRLPPVTLQVKIPSKEEEADMSSPTQR
  TYSSSLKRSSPRTISFRMKPKKENSETTLTRSASMKLPDNTVKLGEKLERYHTAIRRSES
  VKSRGLPCTELFVAPVGVASKRHLFEKELAGQSRAEPASSRKENLRLSGVVTSRLNLWIS
  RTQESGDQDPQEAQKASSATERTQWGQKSDSSLDAEV
• Function: Anchoring filament protein which is a component of the basement membrane zone.

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[1]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[1]
Autoimmune disease	DISORMTM	Strong	Genetic Variation	[2]
Breast cancer	DIS7DPX1	Strong	Biomarker	[3]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[3]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[4]
Bullous pemphigoid	DISOJLKV	Strong	Biomarker	[5]
Cardiac failure	DISDC067	Strong	Biomarker	[6]
Congenital disorder of glycosylation	DIS400QP	Strong	Biomarker	[7]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[8]
Coronary ischemia	DISDJJ5G	Strong	Biomarker	[9]
Depression	DIS3XJ69	Strong	Biomarker	[10]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[11]
Graves disease	DISU4KOQ	Strong	Genetic Variation	[2]
Hyperlipidemia	DIS61J3S	Strong	Biomarker	[8]
Inborn error of immunity	DISNGCMN	Strong	Biomarker	[12]
Intellectual disability	DISMBNXP	Strong	Biomarker	[7]
Junctional epidermolysis bullosa	DISJRXWU	Strong	Altered Expression	[13]
Leukocyte adhesion deficiency	DISEJ9VG	Strong	Genetic Variation	[14]
Leukocyte adhesion deficiency type II	DISYHBB7	Strong	Genetic Variation	[15]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[16]
Mast cell leukaemia	DIS7VQW9	Strong	Biomarker	[17]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[2]
Myocardial infarction	DIS655KI	Strong	Biomarker	[18]
Neoplasm	DISZKGEW	Strong	Altered Expression	[4]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[19]
Peripheral vascular disease	DISXSU1Y	Strong	Genetic Variation	[20]
Pyoderma gangrenosum	DIS8QVTT	Strong	Biomarker	[21]
Skin disease	DISDW8R6	Strong	Biomarker	[5]
Stroke	DISX6UHX	Strong	Biomarker	[8]
Type-1 diabetes	DIS7HLUB	Strong	Biomarker	[22]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[8]
Varicose veins	DISIMBN2	Strong	Genetic Variation	[23]
Vascular disease	DISVS67S	Strong	Biomarker	[24]
Laryngeal carcinoma	DISNHCIV	moderate	Biomarker	[25]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[25]
Periodontitis	DISI9JOI	moderate	Biomarker	[26]
Epidermolysis bullosa	DISVOTZQ	Disputed	Altered Expression	[13]
Coronary heart disease	DIS5OIP1	Limited	Biomarker	[27]
Cutaneous mastocytosis	DISLBZEF	Limited	Biomarker	[28]
Dementia	DISXL1WY	Limited	Biomarker	[29]
Frontotemporal dementia	DISKYHXL	Limited	Biomarker	[29]
Glanzmann thrombasthenia	DISFGGTG	Limited	Biomarker	[30]
Leukocyte adhesion deficiency type 1	DISA1J7W	Limited	Genetic Variation	[31]
Lewy body dementia	DISAE66J	Limited	Biomarker	[29]
Parkinson disease	DISQVHKL	Limited	Biomarker	[29]
Pick disease	DISP6X50	Limited	Biomarker	[29]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Ladinin-1 (LAD1).	[32]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Ladinin-1 (LAD1).	[33]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Ladinin-1 (LAD1).	[34]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Ladinin-1 (LAD1).	[35]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Ladinin-1 (LAD1).	[36]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Ladinin-1 (LAD1).	[37]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Ladinin-1 (LAD1).	[38]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Ladinin-1 (LAD1).	[39]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Ladinin-1 (LAD1).	[40]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Ladinin-1 (LAD1).	[37]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Ladinin-1 (LAD1).	[41]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Ladinin-1 (LAD1).	[42]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of Ladinin-1 (LAD1).	[43]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Ladinin-1 (LAD1).	[44]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Ladinin-1 (LAD1).	[45]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Ladinin-1 (LAD1).	[47]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone increases the expression of Ladinin-1 (LAD1).	[50]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Ladinin-1 (LAD1).	[46]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Ladinin-1 (LAD1).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Ladinin-1 (LAD1).	[49]

References

• [1] Low Cytochrome Oxidase 1 Links Mitochondrial Dysfunction to Atherosclerosis in Mice and Pigs.PLoS One. 2017 Jan 25;12(1):e0170307. doi: 10.1371/journal.pone.0170307. eCollection 2017.
• [2] The interferon-induced helicase C domain-containing protein 1 gene variant (rs1990760) as an autoimmune-based pathology susceptibility factor.Immunobiology. 2020 Jan;225(1):151864. doi: 10.1016/j.imbio.2019.10.013. Epub 2019 Nov 5.
• [3] Heart toxicity from breast cancer radiotherapy : Current findings, assessment, and prevention.Strahlenther Onkol. 2019 Jan;195(1):1-12. doi: 10.1007/s00066-018-1378-z. Epub 2018 Oct 11.
• [4] SILAC identifies LAD1 as a filamin-binding regulator of actin dynamics in response to EGF and a marker of aggressive breast tumors.Sci Signal. 2018 Jan 30;11(515):eaan0949. doi: 10.1126/scisignal.aan0949.
• [5] Checkpoint Inhibition May Trigger the Rare Variant of Anti-LAD-1 IgG-Positive, Anti-BP180 NC16A IgG-Negative Bullous Pemphigoid.Front Immunol. 2019 Aug 14;10:1934. doi: 10.3389/fimmu.2019.01934. eCollection 2019.
• [6] Heat-shock transcription factor 1 is critically involved in the ischaemia-induced cardiac hypertrophy via JAK2/STAT3 pathway.J Cell Mol Med. 2018 Sep;22(9):4292-4303. doi: 10.1111/jcmm.13713. Epub 2018 Jul 11.
• [7] Complementation cloning identifies CDG-IIc, a new type of congenital disorders of glycosylation, as a GDP-fucose transporter deficiency.Nat Genet. 2001 May;28(1):73-6. doi: 10.1038/ng0501-73.
• [8] Cardiac Biomarkers Predict Large Vessel Occlusion in Patients with Ischemic Stroke.J Stroke Cerebrovasc Dis. 2019 Jun;28(6):1726-1731. doi: 10.1016/j.jstrokecerebrovasdis.2019.02.013. Epub 2019 Mar 19.
• [9] PET/CT evaluation of (18)F-FDG uptake in pericoronary adipose tissue in patients with stable coronary artery disease: Independent predictor of atherosclerotic lesions' formation?.J Nucl Cardiol. 2017 Jun;24(3):1075-1084. doi: 10.1007/s12350-015-0370-6. Epub 2016 Mar 7.
• [10] High arrhythmic risk in antero-septal acute myocardial ischemia is explained by increased transmural reentry occurrence.Sci Rep. 2019 Nov 14;9(1):16803. doi: 10.1038/s41598-019-53221-2.
• [11] Soluble RAGE, diabetic nephropathy and genetic variability in the AGER gene.Arch Physiol Biochem. 2008 Apr;114(2):111-9. doi: 10.1080/13813450802033818.
• [12] Successful allogeneic stem cell transplantation with a reduced-intensity conditioning in a leukocyte adhesion deficiency type I patient.Pediatr Transplant. 2011 Mar;15(2):E30-3. doi: 10.1111/j.1399-3046.2009.01239.x.
• [13] The 97 kDa linear IgA bullous dermatosis antigen is not expressed in a patient with generalized atrophic benign epidermolysis bullosa with a novel homozygous G258X mutation in COL17A1.J Invest Dermatol. 1998 Nov;111(5):887-92. doi: 10.1046/j.1523-1747.1998.00363.x.
• [14] A new mutation in the KINDLIN-3 gene ablates integrin-dependent leukocyte, platelet, and osteoclast function in a patient with leukocyte adhesion deficiency-III.Pediatr Blood Cancer. 2015 Sep;62(9):1677-9. doi: 10.1002/pbc.25537. Epub 2015 Apr 8.
• [15] Congenital disorders involving defective N-glycosylation of proteins.Cell Mol Life Sci. 2001 Jul;58(8):1085-104. doi: 10.1007/PL00000923.
• [16] Long intergenic non-coding RNA 00152 promotes lung adenocarcinoma proliferation via interacting with EZH2 and repressing IL24 expression.Mol Cancer. 2017 Jan 21;16(1):17. doi: 10.1186/s12943-017-0581-3.
• [17] Preclinical human models and emerging therapeutics for advanced systemic mastocytosis.Haematologica. 2018 Nov;103(11):1760-1771. doi: 10.3324/haematol.2018.195867. Epub 2018 Jul 5.
• [18] Peptidylarginine Deiminase 2 Knockout Improves Survival in hemorrhagic shock.Shock. 2020 Oct;54(4):458-463. doi: 10.1097/SHK.0000000000001489.
• [19] Metabolic risk profiles in diabetes stratified according to age at onset, islet autoimmunity and fasting C-peptide.Diabetes Res Clin Pract. 2017 Dec;134:62-71. doi: 10.1016/j.diabres.2017.09.014. Epub 2017 Oct 5.
• [20] Incidence and predictors of outcomes after a first definite coronary stent thrombosis.EuroIntervention. 2020 Jul 17;16(4):e344-e350. doi: 10.4244/EIJ-D-19-00219.
• [21] Leukocyte adhesion deficiency-I with a novel intronic mutation presenting with pyoderma gangrenosum- like lesions.J Clin Immunol. 2015 May;35(4):431-4. doi: 10.1007/s10875-015-0155-3. Epub 2015 Apr 16.
• [22] Autoimmunity-Associated PTPN22 Polymorphisms in Latent Autoimmune Diabetes of the Adult Differ from Those of Type 1 Diabetes Patients.Int Arch Allergy Immunol. 2018;177(1):57-68. doi: 10.1159/000489225. Epub 2018 Jun 12.
• [23] Embolization of a complex coronary to pulmonary artery fistula using balloon assisted liquid embolic injection: A novel technique.Catheter Cardiovasc Interv. 2018 Dec 1;92(7):E453-E455. doi: 10.1002/ccd.27677. Epub 2018 Jul 18.
• [24] Intravascular ultrasound of the proximal left anterior descending artery is sufficient to detect early cardiac allograft vasculopathy.Clin Transplant. 2018 Feb;32(2). doi: 10.1111/ctr.13167. Epub 2017 Dec 14.
• [25] Basement membrane protein ladinin-1 and the MIF-CD44-1 integrin signaling axis are implicated in laryngeal cancer metastasis.Biochim Biophys Acta. 2016 Oct;1862(10):1938-54. doi: 10.1016/j.bbadis.2016.07.014. Epub 2016 Jul 25.
• [26] Subgingival microbial communities in Leukocyte Adhesion Deficiency and their relationship with local immunopathology.PLoS Pathog. 2015 Mar 5;11(3):e1004698. doi: 10.1371/journal.ppat.1004698. eCollection 2015 Mar.
• [27] Hybrid coronary revascularization versus off-pump coronary artery bypass grafting and percutaneous coronary intervention for the treatment of two-vessel coronary artery disease with proximal left anterior descending artery stenosis.J Thorac Dis. 2019 Jun;11(6):2402-2409. doi: 10.21037/jtd.2019.05.54.
• [28] Transplantation of purified iPSC-derived cardiomyocytes in myocardial infarction.PLoS One. 2017 May 11;12(5):e0173222. doi: 10.1371/journal.pone.0173222. eCollection 2017.
• [29] CSF/serum albumin ratio in dementias: a cross-sectional study on 1861 patients.Neurobiol Aging. 2017 Nov;59:1-9. doi: 10.1016/j.neurobiolaging.2017.06.028. Epub 2017 Jul 11.
• [30] Leukocyte adhesion deficiency-III is caused by mutations in KINDLIN3 affecting integrin activation.Nat Med. 2009 Mar;15(3):306-12. doi: 10.1038/nm.1931. Epub 2009 Feb 22.
• [31] CD18 deficiency evolving to megakaryocytic (M7) acute myeloid leukemia: case report.Blood Cells Mol Dis. 2014 Dec;53(4):180-4. doi: 10.1016/j.bcmd.2014.07.005. Epub 2014 Aug 5.
• [32] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [33] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [34] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [35] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [36] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [37] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [38] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [39] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [40] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [41] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [42] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [43] p21(WAF1/cip1) is an important determinant of intestinal cell response to sulindac in vitro and in vivo. Cancer Res. 2001 Aug 15;61(16):6297-302.
• [44] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [45] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [46] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [47] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [48] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [49] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [50] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.