Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8P6PT3)

DOT Name	Fibronectin type III and SPRY domain-containing protein 1 (FSD1)
Synonyms	MID1-related protein 1; Microtubule-associated protein GLFND
Gene Name	FSD1
Related Disease	Atrial fibrillation ( ) Acute myocardial infarction ( ) Advanced cancer ( ) Arrhythmia ( ) Bladder cancer ( ) Bone osteosarcoma ( ) Breast cancer ( ) Breast carcinoma ( ) Carcinoma of liver and intrahepatic biliary tract ( ) Clear cell renal carcinoma ( ) Colorectal carcinoma ( ) Colorectal neoplasm ( ) Dilated cardiomyopathy 1A ( ) Duchenne muscular dystrophy ( ) Epithelial ovarian cancer ( ) Esophageal squamous cell carcinoma ( ) Head-neck squamous cell carcinoma ( ) Hepatocellular carcinoma ( ) High blood pressure ( ) Liver cancer ( ) Lung cancer ( ) Lung carcinoma ( ) Metastatic malignant neoplasm ( ) Myocardial infarction ( ) Nasopharyngeal carcinoma ( ) Non-insulin dependent diabetes ( ) Non-small-cell lung cancer ( ) Osteosarcoma ( ) Ovarian cancer ( ) Ovarian neoplasm ( ) Squamous cell carcinoma ( ) Thyroid gland carcinoma ( ) Urinary bladder cancer ( ) Urinary bladder neoplasm ( ) Gastric cancer ( ) Stomach cancer ( ) Cardiac disease ( ) Asthma ( ) Cardiac failure ( ) Cardiovascular disease ( ) Congestive heart failure ( ) Coronary heart disease ( ) Gastric neoplasm ( ) Glioblastoma multiforme ( ) Hereditary diffuse gastric adenocarcinoma ( ) Renal cell carcinoma ( )
UniProt ID	FSD1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00041 ; PF00622
Sequence	MEEQREALRKIIKTLAVKNEEIQSFIYSLKQMLLNVEANSAKVQEDLEAEFQSLFSLLEE LKEGMLMKIKQDRASRTYELQNQLAACTRALESSEELLETANQTLQAMDSEDFPQAAKQI KDGVTMAPAFRLSLKAKVSDNMSHLMVDFAQERQMLQALKFLPVPSAPVIDLAESLVADN CVTLVWRMPDEDSKIDHYVLEYRRTNFEGPPRLKEDQPWMVIEGIRQTEYTLTGLKFDMK YMNFRVKACNKAVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDI KAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAESYTVLGDTLIDGGEHYWEV RYEPDSKAFGVGVAYRSLGRFEQLGKTAASWCLHVNNWLQVSFTAKHANKVKVLDAPVPD CLGVHCDFHQGLLSFYNARTKQVLHTFKTRFTQPLLPAFTVWCGSFQVTTGLQVPSAVRC LQKRGSATSSSNTSLT
Function	May be involved in microtubule organization and stabilization.
Tissue Specificity	Highly expressed in brain tissues, including cerebellum, cerebral cortex, medulla, occipital pole, frontal lobe, temporal lobe and putamen. Lower expression in spinal chord.

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Atrial fibrillation	DIS15W6U	Definitive	Altered Expression	[1]
Acute myocardial infarction	DISE3HTG	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Arrhythmia	DISFF2NI	Strong	Altered Expression	[4]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[5]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Biomarker	[3]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[3]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[9]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Biomarker	[10]
Duchenne muscular dystrophy	DISRQ3NV	Strong	Biomarker	[11]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[12]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[13]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[3]
High blood pressure	DISY2OHH	Strong	Biomarker	[15]
Liver cancer	DISDE4BI	Strong	Biomarker	[3]
Lung cancer	DISCM4YA	Strong	Biomarker	[16]
Lung carcinoma	DISTR26C	Strong	Biomarker	[16]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[17]
Myocardial infarction	DIS655KI	Strong	Biomarker	[18]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Biomarker	[19]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[20]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[21]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[6]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[12]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[12]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[22]
Thyroid gland carcinoma	DISMNGZ0	Strong	Biomarker	[23]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[5]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[5]
Gastric cancer	DISXGOUK	moderate	Altered Expression	[24]
Stomach cancer	DISKIJSX	moderate	Altered Expression	[24]
Cardiac disease	DISVO1I5	Disputed	Genetic Variation	[25]
Asthma	DISW9QNS	Limited	Altered Expression	[26]
Cardiac failure	DISDC067	Limited	Biomarker	[27]
Cardiovascular disease	DIS2IQDX	Limited	Biomarker	[28]
Congestive heart failure	DIS32MEA	Limited	Biomarker	[27]
Coronary heart disease	DIS5OIP1	Limited	Biomarker	[20]
Gastric neoplasm	DISOKN4Y	Limited	Biomarker	[29]
Glioblastoma multiforme	DISK8246	Limited	Altered Expression	[30]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Limited	Biomarker	[29]
Renal cell carcinoma	DISQZ2X8	Limited	Biomarker	[31]
------------------------------------------------------------------------------------


⏷ Show the Full List of 46 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Fibronectin type III and SPRY domain-containing protein 1 (FSD1).	[32]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Fibronectin type III and SPRY domain-containing protein 1 (FSD1).	[33]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Fibronectin type III and SPRY domain-containing protein 1 (FSD1).	[34]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Fibronectin type III and SPRY domain-containing protein 1 (FSD1).	[29]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Fibronectin type III and SPRY domain-containing protein 1 (FSD1).	[37]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Fibronectin type III and SPRY domain-containing protein 1 (FSD1).	[36]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Fibronectin type III and SPRY domain-containing protein 1 (FSD1).	[38]
------------------------------------------------------------------------------------

References

1	Upregulation of miR-133b and miR-328 in Patients With Atrial Dilatation: Implications for Stretch-Induced Atrial Fibrillation.Front Physiol. 2019 Sep 10;10:1133. doi: 10.3389/fphys.2019.01133. eCollection 2019.
2	Circulating myocardial microRNAs from infarcted hearts are carried in exosomes and mobilise bone marrow progenitor cells.Nat Commun. 2019 Feb 27;10(1):959. doi: 10.1038/s41467-019-08895-7.
3	miR-1-3p suppresses proliferation of hepatocellular carcinoma through targeting SOX9.Onco Targets Ther. 2019 Mar 22;12:2149-2157. doi: 10.2147/OTT.S197326. eCollection 2019.
4	Obesity-associated alterations in cardiac connexin-43 and PKC signaling are attenuated by melatonin and omega-3 fatty acids in female rats.Mol Cell Biochem. 2019 Apr;454(1-2):191-202. doi: 10.1007/s11010-018-3463-0. Epub 2018 Nov 16.
5	MiR-1-3p inhibits cell proliferation and invasion by regulating BDNF-TrkB signaling pathway in bladder cancer.Neoplasma. 2018;65(1):89-96. doi: 10.4149/neo_2018_161128N594.
6	MiR-1 Suppresses Proliferation of Osteosarcoma Cells by Up-regulating p21 via PAX3.Cancer Genomics Proteomics. 2019 Jan-Feb;16(1):71-79. doi: 10.21873/cgp.20113.
7	Identification of microRNA expression in sentinel lymph nodes from patients with breast cancer via RNA sequencing for diagnostic accuracy.J Gene Med. 2019 Apr;21(4):e3075. doi: 10.1002/jgm.3075. Epub 2019 Mar 3.
8	Role of miR-1 expression in clear cell renal cell carcinoma (ccRCC): A bioinformatics study based on GEO, ArrayExpress microarrays and TCGA database.Pathol Res Pract. 2018 Feb;214(2):195-206. doi: 10.1016/j.prp.2017.11.025. Epub 2017 Dec 2.
9	PTBP1-associated microRNA-1 and -133b suppress the Warburg effect in colorectal tumors.Oncotarget. 2016 Apr 5;7(14):18940-52. doi: 10.18632/oncotarget.8005.
10	Liver X receptor is targeted by microRNA-1 to inhibit cardiomyocyte apoptosis through a ROS-mediated mitochondrial pathway.Biochem Cell Biol. 2018 Feb;96(1):11-18. doi: 10.1139/bcb-2017-0154. Epub 2017 Oct 12.
11	Uniform sarcolemmal dystrophin expression is required to prevent extracellular microRNA release and improve dystrophic pathology.J Cachexia Sarcopenia Muscle. 2020 Apr;11(2):578-593. doi: 10.1002/jcsm.12506. Epub 2019 Dec 17.
12	MicroRNA-1 inhibits ovarian cancer cell proliferation and migration through c-Met pathway.Clin Chim Acta. 2017 Oct;473:237-244. doi: 10.1016/j.cca.2017.07.008. Epub 2017 Jul 8.
13	microRNA-messenger RNA regulatory network of esophageal squamous cell carcinoma and the identification of miR-1 as a biomarker of patient survival.J Cell Biochem. 2019 Aug;120(8):12259-12272. doi: 10.1002/jcb.28166. Epub 2019 Apr 24.
14	Dual-receptor (EGFR and c-MET) inhibition by tumor-suppressive miR-1 and miR-206 in head and neck squamous cell carcinoma.J Hum Genet. 2017 Jan;62(1):113-121. doi: 10.1038/jhg.2016.47. Epub 2016 May 12.
15	miR-1 is increased in pulmonary hypertension and downregulates Kv1.5 channels in rat pulmonary arteries.J Physiol. 2019 Feb;597(4):1185-1197. doi: 10.1113/JP276054. Epub 2018 Jun 21.
16	miR-1-3p and miR-206 sensitizes HGF-induced gefitinib-resistant human lung cancer cells through inhibition of c-Met signalling and EMT.J Cell Mol Med. 2018 Jul;22(7):3526-3536. doi: 10.1111/jcmm.13629. Epub 2018 Apr 17.
17	ADAM9 enhances CDCP1 by inhibiting miR-1 through EGFR signaling activation in lung cancer metastasis.Oncotarget. 2017 Jul 18;8(29):47365-47378. doi: 10.18632/oncotarget.17648.
18	MicroRNA? downregulation induced by carvedilol protects cardiomyocytes against apoptosis by targeting heat shock protein 60.Mol Med Rep. 2019 May;19(5):3527-3536. doi: 10.3892/mmr.2019.10034. Epub 2019 Mar 14.
19	The role of MALAT1/miR-1/slug axis on radioresistance in nasopharyngeal carcinoma.Tumour Biol. 2016 Mar;37(3):4025-33. doi: 10.1007/s13277-015-4227-z. Epub 2015 Oct 20.
20	Upregulation of Circulating Cardiomyocyte-Enriched miR-1 and miR-133 Associate with the Risk of Coronary Artery Disease in Type 2 Diabetes Patients and Serve as Potential Biomarkers.J Cardiovasc Transl Res. 2019 Aug;12(4):347-357. doi: 10.1007/s12265-018-9857-2. Epub 2019 Jan 4.
21	Long noncoding RNA RMRP promotes proliferation and invasion via targeting miR-1-3p in non-small-cell lung cancer.J Cell Biochem. 2019 Sep;120(9):15170-15181. doi: 10.1002/jcb.28779. Epub 2019 May 3.
22	Downregulation of miR-1 enhances tumorigenicity and invasiveness in oral squamous cell carcinomas.J Formos Med Assoc. 2017 Oct;116(10):782-789. doi: 10.1016/j.jfma.2016.12.003. Epub 2017 Jan 12.
23	The long non-coding RNA HOTAIR promotes thyroid cancer cell growth, invasion and migration through the miR-1-CCND2 axis.Am J Cancer Res. 2017 Jun 1;7(6):1298-1309. eCollection 2017.
24	MiR-1-3p suppresses cell proliferation and invasion and targets STC2 in gastric cancer.Eur Rev Med Pharmacol Sci. 2019 Oct;23(20):8870-8877. doi: 10.26355/eurrev_201910_19282.
25	Circulating MicroRNA in patients with repaired tetralogy of Fallot.Eur J Clin Invest. 2017 Aug;47(8):574-582. doi: 10.1111/eci.12778. Epub 2017 Jul 18.
26	The Clinical Significance of Changes in the Expression Levels of MicroRNA-1 and Inflammatory Factors in the Peripheral Blood of Children with Acute-Stage Asthma.Biomed Res Int. 2018 Jun 26;2018:7632487. doi: 10.1155/2018/7632487. eCollection 2018.
27	MiR-1a-3p mitigates isoproterenol-induced heart failure by enhancing the expression of mitochondrial ND1 and COX1.Exp Cell Res. 2019 May 1;378(1):87-97. doi: 10.1016/j.yexcr.2019.03.012. Epub 2019 Mar 7.
28	MicroRNA?4a mediates atrial fibrillation through regulation of AnkyrinB expression.Mol Med Rep. 2018 Jun;17(6):8457-8465. doi: 10.3892/mmr.2018.8873. Epub 2018 Apr 12.
29	Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
30	MicroRNA-1 suppresses glioblastoma in preclinical models by targeting fibronectin.Cancer Lett. 2019 Nov 28;465:59-67. doi: 10.1016/j.canlet.2019.08.021. Epub 2019 Sep 3.
31	miR-1-3p suppresses the epithelial-mesenchymal transition property in renal cell cancer by downregulating Fibronectin 1.Cancer Manag Res. 2019 Jun 21;11:5573-5587. doi: 10.2147/CMAR.S200707. eCollection 2019.
32	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
33	Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
34	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
35	Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
36	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
37	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
38	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.