Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9AGQKH)

• DOT Name: Galectin-3-binding protein (LGALS3BP)
• Synonyms: Basement membrane autoantigen p105; Lectin galactoside-binding soluble 3-binding protein; Mac-2-binding protein; MAC2BP; Mac-2 BP; Tumor-associated antigen 90K
• Gene Name: LGALS3BP
• Related Disease:
  Autoimmune disease
  Colorectal carcinoma
  Neuroblastoma
  Advanced cancer
  Breast cancer
  Carcinoma of liver and intrahepatic biliary tract
  Cardiovascular disease
  Chronic hepatitis B virus infection
  Clear cell renal carcinoma
  Colon cancer
  Colon carcinoma
  Coronary heart disease
  Esophageal squamous cell carcinoma
  Gastric cancer
  Glioblastoma multiforme
  Hepatitis C virus infection
  Hepatocellular carcinoma
  Liver cancer
  Liver cirrhosis
  Lung carcinoma
  Matthew-Wood syndrome
  Metastatic malignant neoplasm
  Neoplasm
  Non-alcoholic steatohepatitis
  Pancreatic cancer
  Primary biliary cholangitis
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Rheumatoid arthritis
  Squamous cell carcinoma
  Stomach cancer
  Systemic lupus erythematosus
  Viral hepatitis
  Breast carcinoma
  Chronic pancreatitis
  Lung cancer
  Ovarian neoplasm
  Arteriosclerosis
  Asthma
  Atherosclerosis
  Coronary atherosclerosis
  Cryohydrocytosis
  Hepatitis B virus infection
  Non-alcoholic fatty liver disease
  Type-1/2 diabetes
• UniProt ID: LG3BP_HUMAN
• PDB ID: 1BY2; 6GFB
• Pfam ID: PF07707 ; PF00530
• Sequence:
  MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASV
  VCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAG
  VVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANL
  EAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLASAYGARQLQ
  GYCASLFAILLPQDPSFQMPLDLYAYAVATGDALLEKLCLQFLAWNFEALTQAEAWPSVP
  TDLLQLLLPRSDLAVPSELALLKAVDTWSWGERASHEEVEGLVEKIRFPMMLPEELFELQ
  FNLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTSPTWSAFVTD
  SSWSARKSQLVYQSRRGPLVKYSSDYFQAPSDYRYYPYQSFQTPQHPSFLFQDKRVSWSL
  VYLPTIQSCWNYGFSCSSDELPVLGLTKSGGSDRTIAYENKALMLCEGLFVADVTDFEGW
  KAAIPSALDTNSSKSTSSFPCPAGHFNGFRTVIRPFYLTNSSGVD
• Function: Promotes integrin-mediated cell adhesion. May stimulate host defense against viruses and tumor cells.
• Tissue Specificity: Ubiquitous. Detected in body fluids such as semen, milk, serum, tears, saliva and urine. Expressed by keratinocytes and fibroblasts.
• Reactome Pathway: Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Autoimmune disease	DISORMTM	Definitive	Altered Expression	[1]
Colorectal carcinoma	DIS5PYL0	Definitive	Biomarker	[1]
Neuroblastoma	DISVZBI4	Definitive	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Biomarker	[5]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[6]
Chronic hepatitis B virus infection	DISHL4NT	Strong	Biomarker	[7]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[8]
Colon cancer	DISVC52G	Strong	Biomarker	[9]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[9]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[10]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[11]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[12]
Glioblastoma multiforme	DISK8246	Strong	Genetic Variation	[13]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[7]
Liver cancer	DISDE4BI	Strong	Biomarker	[5]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[7]
Lung carcinoma	DISTR26C	Strong	Biomarker	[15]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[16]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[17]
Neoplasm	DISZKGEW	Strong	Biomarker	[18]
Non-alcoholic steatohepatitis	DIST4788	Strong	Altered Expression	[19]
Pancreatic cancer	DISJC981	Strong	Biomarker	[20]
Primary biliary cholangitis	DIS43E0O	Strong	Biomarker	[21]
Prostate cancer	DISF190Y	Strong	Biomarker	[22]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[22]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[8]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[23]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[24]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[12]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[25]
Viral hepatitis	DISVT5Q7	Strong	Biomarker	[26]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[17]
Chronic pancreatitis	DISBUOMJ	moderate	Altered Expression	[27]
Lung cancer	DISCM4YA	moderate	Biomarker	[15]
Ovarian neoplasm	DISEAFTY	moderate	Altered Expression	[28]
Arteriosclerosis	DISK5QGC	Limited	Biomarker	[10]
Asthma	DISW9QNS	Limited	Biomarker	[29]
Atherosclerosis	DISMN9J3	Limited	Biomarker	[10]
Coronary atherosclerosis	DISKNDYU	Limited	Biomarker	[10]
Cryohydrocytosis	DISMQHL3	Limited	Altered Expression	[30]
Hepatitis B virus infection	DISLQ2XY	Limited	Altered Expression	[31]
Non-alcoholic fatty liver disease	DISDG1NL	Limited	Biomarker	[32]
Type-1/2 diabetes	DISIUHAP	Limited	Altered Expression	[5]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Galectin-3-binding protein (LGALS3BP) affects the response to substance of Fluorouracil.	[50]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Galectin-3-binding protein (LGALS3BP).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Galectin-3-binding protein (LGALS3BP).	[46]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Galectin-3-binding protein (LGALS3BP).	[34]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Galectin-3-binding protein (LGALS3BP).	[35]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Galectin-3-binding protein (LGALS3BP).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Galectin-3-binding protein (LGALS3BP).	[37]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Galectin-3-binding protein (LGALS3BP).	[38]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Galectin-3-binding protein (LGALS3BP).	[39]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Galectin-3-binding protein (LGALS3BP).	[40]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Galectin-3-binding protein (LGALS3BP).	[41]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Galectin-3-binding protein (LGALS3BP).	[42]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Galectin-3-binding protein (LGALS3BP).	[43]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Galectin-3-binding protein (LGALS3BP).	[44]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Galectin-3-binding protein (LGALS3BP).	[45]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Galectin-3-binding protein (LGALS3BP).	[47]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Galectin-3-binding protein (LGALS3BP).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Galectin-3-binding protein (LGALS3BP).	[49]

References

• [1] Dendritic cell-specific intercellular adhesion molecule 3-grabbing non-integrin (DC-SIGN) recognizes a novel ligand, Mac-2-binding protein, characteristically expressed on human colorectal carcinomas.J Biol Chem. 2011 Jun 24;286(25):22403-13. doi: 10.1074/jbc.M110.215301. Epub 2011 Apr 22.
• [2] A galectin-3-dependent pathway upregulates interleukin-6 in the microenvironment of human neuroblastoma.Cancer Res. 2012 May 1;72(9):2228-38. doi: 10.1158/0008-5472.CAN-11-2165. Epub 2012 Mar 2.
• [3] Secreted Gal-3BP is a novel promising target for non-internalizing Antibody-Drug Conjugates.J Control Release. 2019 Jan 28;294:176-184. doi: 10.1016/j.jconrel.2018.12.018. Epub 2018 Dec 13.
• [4] Two E-selectin ligands, BST-2 and LGALS3BP, predict metastasis and poor survival of ER-negative breast cancer.Int J Oncol. 2016 Jul;49(1):265-75. doi: 10.3892/ijo.2016.3521. Epub 2016 May 13.
• [5] Wisteria floribunda agglutinin-positive human Mac-2 binding protein predicts the risk of HBV-related liver cancer development.Liver Int. 2017 Jun;37(6):879-887. doi: 10.1111/liv.13341. Epub 2016 Dec 28.
• [6] Female sex, high soluble CD163, and low HDL-cholesterol were associated with high galectin-3 binding protein in type 1 diabetes.Biol Sex Differ. 2019 Nov 21;10(1):51. doi: 10.1186/s13293-019-0268-0.
• [7] Serum Mac-2-Binding Protein Glycosylation Isomer at Virological Remission Predicts Hepatocellular Carcinoma and Death in Chronic Hepatitis B-Related Cirrhosis.J Infect Dis. 2020 Feb 3;221(4):589-597. doi: 10.1093/infdis/jiz496.
• [8] Profilin 1 overexpression in renal cell carcinoma.Int J Urol. 2011 Jan;18(1):63-71. doi: 10.1111/j.1442-2042.2010.02670.x. Epub 2010 Nov 22.
• [9] The tumor-associated antigen 90K/Mac-2-binding protein secreted by human colon carcinoma cells enhances extracellular levels of promatrilysin and is a novel substrate of matrix metalloproteinases-2, -7 (matrilysin) and -9: Implications of proteolytic cleavage.Biochim Biophys Acta. 2010 Mar;1800(3):336-43. doi: 10.1016/j.bbagen.2009.07.030. Epub 2009 Aug 7.
• [10] Expression of Mac-2 binding protein in human carotid atheroma is associated with plaque instability and clinical manifestations.Biomed Pharmacother. 2019 Feb;110:465-472. doi: 10.1016/j.biopha.2018.12.015. Epub 2018 Dec 6.
• [11] Are Serum Mac 2-Binding Protein Levels Elevated in Esophageal Cancer? A Control Study of Esophageal Squamous Cell Carcinoma Patients.Dis Markers. 2018 Apr 17;2018:3610239. doi: 10.1155/2018/3610239. eCollection 2018.
• [12] Up-regulation of Mac-2 binding protein by hTERT in gastric cancer.Int J Cancer. 2007 Feb 15;120(4):813-20. doi: 10.1002/ijc.22369.
• [13] Increased LGALS3 expression independently predicts shorter overall survival in patients with the proneural subtype of glioblastoma.Cancer Med. 2019 May;8(5):2031-2040. doi: 10.1002/cam4.2075. Epub 2019 Mar 7.
• [14] Diagnostic Accuracy of Acoustic Radiation Force Impulse (ARFI) and Wisteria floribunda Agglutinin-Positive Mac-2-Binding Protein (WFA?M2BP) in Patients with Chronic Liver Disease.Med Sci Monit. 2019 Sep 24;25:7169-7174. doi: 10.12659/MSM.916533.
• [15] Lectin, Galactoside-Binding Soluble 3 Binding Protein Promotes 17-N-Allylamino-17-demethoxygeldanamycin Resistance through PI3K/Akt Pathway in Lung Cancer Cell Line.Mol Cancer Ther. 2017 Jul;16(7):1355-1365. doi: 10.1158/1535-7163.MCT-16-0574. Epub 2017 Mar 23.
• [16] Clinical significance of serum Wisteria floribunda agglutinin-positive Mac-2 binding protein in pancreatic ductal adenocarcinoma.Pancreatology. 2016 Nov-Dec;16(6):1044-1050. doi: 10.1016/j.pan.2016.09.003. Epub 2016 Sep 7.
• [17] Galectin-3 Binding Protein Secreted by Breast Cancer Cells Inhibits Monocyte-Derived Fibrocyte Differentiation.J Immunol. 2015 Aug 15;195(4):1858-67. doi: 10.4049/jimmunol.1500365. Epub 2015 Jul 1.
• [18] Glycoprotein 90K Promotes E-Cadherin Degradation in a Cell Density-Dependent Manner via Dissociation of E-Cadherin-p120-Catenin Complex.Int J Mol Sci. 2017 Dec 2;18(12):2601. doi: 10.3390/ijms18122601.
• [19] Serum Wisteria floribunda agglutinin-positive Mac-2-binding protein levels predict the presence of fibrotic nonalcoholic steatohepatitis (NASH) and NASH cirrhosis.PLoS One. 2018 Aug 30;13(8):e0202226. doi: 10.1371/journal.pone.0202226. eCollection 2018.
• [20] Spectral library-based glycopeptide analysis-detection of circulating galectin-3 binding protein in pancreatic cancer.Proteomics Clin Appl. 2017 Sep;11(9-10):10.1002/prca.201700064. doi: 10.1002/prca.201700064. Epub 2017 Jul 10.
• [21] Clinical utility of FibroScan as a non-invasive diagnostic test for primary biliary cholangitis.J Gastroenterol Hepatol. 2020 Jul;35(7):1208-1214. doi: 10.1111/jgh.14929. Epub 2019 Dec 10.
• [22] Differences in urinary proteins related to surgical margin status after radical prostatectomy.Oncol Rep. 2015 Dec;34(6):3247-55. doi: 10.3892/or.2015.4322.
• [23] Galectin 3 and its binding protein in rheumatoid arthritis.Arthritis Rheum. 2003 Oct;48(10):2788-95. doi: 10.1002/art.11287.
• [24] Increased LGALS3BP promotes proliferation and migration of oral squamous cell carcinoma via PI3K/AKT pathway.Cell Signal. 2019 Nov;63:109359. doi: 10.1016/j.cellsig.2019.109359. Epub 2019 Jul 11.
• [25] Stimulation of Mononuclear Cells Through Toll-Like Receptor 9 Induces Release of Microvesicles Expressing Double-Stranded DNA and Galectin 3-Binding Protein in an Interferon--Dependent Manner.Front Immunol. 2019 Oct 11;10:2391. doi: 10.3389/fimmu.2019.02391. eCollection 2019.
• [26] On-treatment changes of serum Wisteria floribunda agglutinin-positive Mac-2 binding protein are associated with the regression of liver fibrosis in chronic hepatitis B patients on interferon add-on therapy.J Med Virol. 2019 Aug;91(8):1499-1509. doi: 10.1002/jmv.25465. Epub 2019 Apr 16.
• [27] Serum levels of Wisteria floribunda agglutinin-positive Mac-2 binding protein reflect the severity of chronic pancreatitis.J Dig Dis. 2017 May;18(5):302-308. doi: 10.1111/1751-2980.12475.
• [28] Mac-2 binding protein and galectin-3 expression in mucinous tumours of the ovary: an annealing control primer system and immunohistochemical study.Pathology. 2009;41(3):229-33. doi: 10.1080/00313020902756279.
• [29] Role of 90K protein in asthma and TH2-type cytokine expression.Ann Allergy Asthma Immunol. 2004 Nov;93(5):485-92. doi: 10.1016/S1081-1206(10)61417-2.
• [30] Clinical Evaluation of Hepatocarcinogenesis and Outcome Using a Novel Glycobiomarker Wisteria floribunda Agglutinin-Positive Mac-2 Binding Protein (WFA(+)-M2BP) in Chronic Hepatitis C with Advanced Fibrosis.Jpn J Infect Dis. 2018 May 24;71(3):177-183. doi: 10.7883/yoken.JJID.2017.459. Epub 2018 Feb 28.
• [31] Serum Wisteria floribunda agglutinin-positive Mac-2-binding protein evaluates liver function and predicts prognosis in liver cirrhosis.J Dig Dis. 2018 Apr;19(4):242-253. doi: 10.1111/1751-2980.12596.
• [32] Wisteria floribunda agglutinin-positive mac-2 binding protein as an age-independent fibrosis marker in nonalcoholic fatty liver disease.Sci Rep. 2019 Jul 12;9(1):10109. doi: 10.1038/s41598-019-46172-1.
• [33] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [34] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [35] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [36] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [39] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [40] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [41] Integrated assessment by multiple gene expression analysis of quercetin bioactivity on anticancer-related mechanisms in colon cancer cells in vitro. Eur J Nutr. 2005 Mar;44(3):143-56. doi: 10.1007/s00394-004-0503-1. Epub 2004 Apr 30.
• [42] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [43] Proteomics-based identification of differentially abundant proteins from human keratinocytes exposed to arsenic trioxide. J Proteomics Bioinform. 2014 Jul;7(7):166-178.
• [44] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [45] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [46] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [47] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [48] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [49] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [50] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.