Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9EROL6)

• DOT Name: Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1)
• Synonyms: Methyl methanesulfonate (MMF)-inducible fragment protein 1
• Gene Name: HERPUD1
• Related Disease:
  Urinary bladder cancer
  Urinary bladder neoplasm
  Acute lymphocytic leukaemia
  Adult T-cell leukemia/lymphoma
  Advanced cancer
  Alcohol dependence
  Alpha-1 antitrypsin deficiency
  Anaplastic large cell lymphoma
  Ataxia-telangiectasia
  Bladder cancer
  Burkitt lymphoma
  Childhood acute lymphoblastic leukemia
  Chromosomal disorder
  Classic Hodgkin lymphoma
  Endometrial cancer
  Endometrial carcinoma
  Glioma
  Late-onset Parkinson disease
  leukaemia
  Leukemia
  Liver cirrhosis
  Metastatic malignant neoplasm
  Neoplasm
  Niemann-Pick disease, type C1
  Obstructive sleep apnea
  Parkinson disease
  Prostate carcinoma
  Prostate neoplasm
  T-cell leukaemia
  Tarsal-carpal coalition syndrome
  Plasma cell myeloma
  Adult lymphoma
  Lymphoma
  Pediatric lymphoma
  Prostate cancer
• UniProt ID: HERP1_HUMAN
• PDB ID: 1WGD
• Pfam ID: PF00240
• Sequence:
  MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSG
  KLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDS
  SSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ
  YYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVVVNPGA
  NQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSVFLSILYFYSSLSRFLMVMGATVVM
  YLHHVGWFPFRPRPVQNFPNDGPPPDVVNQDPNNNLQEGTDPETEDPNHLPPDRDVLDGE
  QTSPSFMSTAWLVFKTFFASLLPEGPPAIAN
• Function: Component of the endoplasmic reticulum quality control (ERQC) system also called ER-associated degradation (ERAD) involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. Could enhance presenilin-mediated amyloid-beta protein 40 generation. Binds to ubiquilins and this interaction is required for efficient degradation of CD3D via the ERAD pathway.
• Tissue Specificity: Widely expressed; in the brain, expression seems to be restricted to neurons and vascular smooth muscle cells. Present in activated microglia in senile plaques in the brain of patients with Alzheimer disease.
• KEGG Pathway: Protein processing in endoplasmic reticulum (hsa04141)
• Reactome Pathway: ATF4 activates genes in response to endoplasmic reticulum stress (R-HSA-380994)

Molecular Interaction Atlas (MIA) of This DOT

35 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Urinary bladder cancer	DISDV4T7	Definitive	Biomarker	[1]
Urinary bladder neoplasm	DIS7HACE	Definitive	Biomarker	[1]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[2]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Biomarker	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Alcohol dependence	DIS4ZSCO	Strong	Biomarker	[5]
Alpha-1 antitrypsin deficiency	DISQKEHW	Strong	Genetic Variation	[6]
Anaplastic large cell lymphoma	DISP4D1R	Strong	Genetic Variation	[7]
Ataxia-telangiectasia	DISP3EVR	Strong	Biomarker	[8]
Bladder cancer	DISUHNM0	Strong	Biomarker	[1]
Burkitt lymphoma	DIS9D5XU	Strong	Genetic Variation	[9]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[2]
Chromosomal disorder	DISM5BB5	Strong	Biomarker	[10]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[11]
Endometrial cancer	DISW0LMR	Strong	Biomarker	[12]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[12]
Glioma	DIS5RPEH	Strong	Altered Expression	[13]
Late-onset Parkinson disease	DIS9IOUI	Strong	Altered Expression	[14]
leukaemia	DISS7D1V	Strong	Genetic Variation	[15]
Leukemia	DISNAKFL	Strong	Genetic Variation	[15]
Liver cirrhosis	DIS4G1GX	Strong	Genetic Variation	[6]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[16]
Neoplasm	DISZKGEW	Strong	Altered Expression	[17]
Niemann-Pick disease, type C1	DIS9HUE3	Strong	Biomarker	[18]
Obstructive sleep apnea	DIS0SVD1	Strong	Biomarker	[19]
Parkinson disease	DISQVHKL	Strong	Altered Expression	[14]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[20]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[21]
T-cell leukaemia	DISJ6YIF	Strong	Genetic Variation	[22]
Tarsal-carpal coalition syndrome	DISY90L2	Strong	Biomarker	[1]
Plasma cell myeloma	DIS0DFZ0	moderate	Biomarker	[23]
Adult lymphoma	DISK8IZR	Limited	Biomarker	[24]
Lymphoma	DISN6V4S	Limited	Biomarker	[24]
Pediatric lymphoma	DIS51BK2	Limited	Biomarker	[24]
Prostate cancer	DISF190Y	Limited	Biomarker	[21]

35 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[25]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[26]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[27]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[28]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[29]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[30]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[31]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[32]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[33]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[34]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[35]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[36]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[31]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[37]
Thalidomide	DM70BU5	Approved	Thalidomide increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[38]
Vitamin C	DMXJ7O8	Approved	Vitamin C decreases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[39]
Sertraline	DM0FB1J	Approved	Sertraline increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[40]
Nefazodone	DM4ZS8M	Approved	Nefazodone increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[41]
Bexarotene	DMOBIKY	Approved	Bexarotene decreases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[42]
Racecadotril	DMFOTZ7	Approved	Racecadotril increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[43]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[44]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[45]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[46]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[47]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[29]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[48]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[50]
Milchsaure	DM462BT	Investigative	Milchsaure affects the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[51]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[52]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[53]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[54]
Bilirubin	DMI0V4O	Investigative	Bilirubin increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[55]
acrolein	DMAMCSR	Investigative	acrolein increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[56]
L-Serine	DM6WPIS	Investigative	L-Serine increases the expression of Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1).	[57]

References

• [1] Prognostic and functional significance of thromboxane synthase gene overexpression in invasive bladder cancer.Cancer Res. 2005 Dec 15;65(24):11581-7. doi: 10.1158/0008-5472.CAN-05-1622.
• [2] Long non-coding RNA SNHG16 has Tumor suppressing effect in acute lymphoblastic leukemia by inverse interaction on hsa-miR-124-3p.IUBMB Life. 2019 Jan;71(1):134-142. doi: 10.1002/iub.1947. Epub 2018 Oct 31.
• [3] Molecular analysis of TCRB and ABL in a t(7;9)-containing cell line (SUP-T3) from a human T-cell leukemia.Proc Natl Acad Sci U S A. 1987 Jan;84(1):251-5. doi: 10.1073/pnas.84.1.251.
• [4] Age-related gene expression changes, and transcriptome wide association study of physical and cognitive aging traits, in the Lothian Birth Cohort 1936.Aging (Albany NY). 2017 Dec 1;9(12):2489-2503. doi: 10.18632/aging.101333.
• [5] Epigenetic DNA hypermethylation of the HERP gene promoter induces down-regulation of its mRNA expression in patients with alcohol dependence.Alcohol Clin Exp Res. 2006 Apr;30(4):587-91. doi: 10.1111/j.1530-0277.2006.00068.x.
• [6] ERAD defects and the HFE-H63D variant are associated with increased risk of liver damages in Alpha 1-Antitrypsin Deficiency.PLoS One. 2017 Jun 15;12(6):e0179369. doi: 10.1371/journal.pone.0179369. eCollection 2017.
• [7] Mitochondrial Hyperactivation and Enhanced ROS Production are Involved in Toxicity Induced by Oncogenic Kinases Over-Signaling.Cancers (Basel). 2018 Dec 12;10(12):509. doi: 10.3390/cancers10120509.
• [8] Molecular characterization of ataxia telangiectasia T cell clones. II. The clonal inv(14) in ataxia telangiectasia differs from the inv(14) in T cell lymphoma.Hum Genet. 1988 Apr;78(4):316-9. doi: 10.1007/BF00291726.
• [9] Multiprotein complexes present at the MIF motifs flanking the promoter of the human c-myc gene.FEBS Lett. 2000 May 26;474(1):23-8. doi: 10.1016/s0014-5793(00)01562-3.
• [10] Establishment and characterization of a common acute lymphoblastic leukemia cell line with a deletion of chromosome 3 band q26.Cancer Res. 1987 Mar 15;47(6):1652-6.
• [11] The restricted expression pattern of the Hodgkin's lymphoma-associated cytokine receptor CD30 is regulated by a minimal promoter.J Pathol. 2000 Oct;192(2):182-93. doi: 10.1002/1096-9896(2000)9999:9999<::AID-PATH691>3.0.CO;2-X.
• [12] Medroxyprogesterone acetate causes the alterations of endoplasmic reticulum related mRNAs and lncRNAs in endometrial cancer cells.BMC Med Genomics. 2019 Nov 12;12(1):163. doi: 10.1186/s12920-019-0601-9.
• [13] MiR-9-3p augments apoptosis induced by H2O2 through down regulation of Herpud1 in glioma.PLoS One. 2017 Apr 21;12(4):e0174839. doi: 10.1371/journal.pone.0174839. eCollection 2017.
• [14] Homocysteine-induced endoplasmic reticulum protein (herp) is up-regulated in parkinsonian substantia nigra and present in the core of Lewy bodies.Clin Neuropathol. 2009 Sep-Oct;28(5):333-43.
• [15] Identification of substituted 5-membered heterocyclic compounds as potential anti-leukemic agents.Eur J Med Chem. 2019 Feb 15;164:391-398. doi: 10.1016/j.ejmech.2018.12.059. Epub 2018 Dec 24.
• [16] Evolution of the androgen receptor pathway during progression of prostate cancer.Cancer Res. 2006 May 15;66(10):5012-20. doi: 10.1158/0008-5472.CAN-05-3082.
• [17] Transcriptomic Profiling of MDA-MB-231 Cells Exposed to Boswellia Serrata and 3-O-Acetyl-B-Boswellic Acid; ER/UPR Mediated Programmed Cell Death.Cancer Genomics Proteomics. 2017 Nov-Dec;14(6):409-425. doi: 10.21873/cgp.20051.
• [18] Niemann-Pick disease type C1(NPC1) is involved in resistance against imatinib in the imatinib-resistant Ph+ acute lymphoblastic leukemia cell line SUP-B15/RI.Leuk Res. 2016 Mar;42:59-67. doi: 10.1016/j.leukres.2016.01.007. Epub 2016 Jan 16.
• [19] The use of handheld nasal spirometry to predict the presence of obstructive sleep apnea.Sleep Breath. 2018 Mar;22(1):79-84. doi: 10.1007/s11325-017-1531-4. Epub 2017 Jun 30.
• [20] Androgen-induced expression of endoplasmic reticulum (ER) stress response genes in prostate cancer cells.Oncogene. 2002 Dec 12;21(57):8749-58. doi: 10.1038/sj.onc.1205992.
• [21] Identification of genes potentially involved in the acquisition of androgen-independent and metastatic tumor growth in an autochthonous genetically engineered mouse prostate cancer model.Prostate. 2007 Jan 1;67(1):83-106. doi: 10.1002/pros.20505.
• [22] Characterization of a high-molecular-weight Notch complex in the nucleus of Notch(ic)-transformed RKE cells and in a human T-cell leukemia cell line.Mol Cell Biol. 2002 Jun;22(11):3927-41. doi: 10.1128/MCB.22.11.3927-3941.2002.
• [23] Macrophage Inhibitory Factor-1 (MIF-1) controls the plasticity of multiple myeloma tumor cells.PLoS One. 2018 Nov 1;13(11):e0206368. doi: 10.1371/journal.pone.0206368. eCollection 2018.
• [24] Chemical evaluation and cytotoxic mechanism investigation of Clinacanthus nutans extract in lymphoma SUP-T1 cells.Environ Toxicol. 2018 Dec;33(12):1229-1236. doi: 10.1002/tox.22629. Epub 2018 Sep 6.
• [25] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [26] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [27] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [28] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [29] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [30] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [31] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [32] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [33] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [34] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [35] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [36] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [37] Growth-suppressive effect of non-steroidal anti-inflammatory drugs on 11 colon-cancer cell lines and fluorescence differential display of genes whose expression is influenced by sulindac. Int J Cancer. 2000 Dec 15;88(6):873-80. doi: 10.1002/1097-0215(20001215)88:6<873::aid-ijc6>3.0.co;2-b.
• [38] Polyunsaturated fatty acids synergize with lipid droplet binding thalidomide analogs to induce oxidative stress in cancer cells. Lipids Health Dis. 2010 Jun 2;9:56. doi: 10.1186/1476-511X-9-56.
• [39] Antiproliferative effect of ascorbic acid is associated with the inhibition of genes necessary to cell cycle progression. PLoS One. 2009;4(2):e4409.
• [40] Sertraline induces endoplasmic reticulum stress in hepatic cells. Toxicology. 2014 Aug 1;322:78-88. doi: 10.1016/j.tox.2014.05.007. Epub 2014 May 24.
• [41] Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
• [42] Identification of biomarkers modulated by the rexinoid LGD1069 (bexarotene) in human breast cells using oligonucleotide arrays. Cancer Res. 2006 Dec 15;66(24):12009-18.
• [43] Successful validation of genomic biomarkers for human immunotoxicity in Jurkat T cells in vitro. J Appl Toxicol. 2015 Jul;35(7):831-41.
• [44] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [45] Molecular mechanisms of action of angiopreventive anti-oxidants on endothelial cells: microarray gene expression analyses. Mutat Res. 2005 Dec 11;591(1-2):198-211.
• [46] The transforming growth factor-beta family members bone morphogenetic protein-2 and macrophage inhibitory cytokine-1 as mediators of the antiangiogenic activity of N-(4-hydroxyphenyl)retinamide. Clin Cancer Res. 2005 Jun 15;11(12):4610-9.
• [47] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [48] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [49] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [50] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [51] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [52] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [53] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [54] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [55] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
• [56] Role of endoplasmic reticulum stress in acrolein-induced endothelial activation. Toxicol Appl Pharmacol. 2009 Jan 1;234(1):14-24. doi: 10.1016/j.taap.2008.09.019. Epub 2008 Oct 7.
• [57] Mechanisms of L-Serine Neuroprotection in vitro Include ER Proteostasis Regulation. Neurotox Res. 2018 Jan;33(1):123-132. doi: 10.1007/s12640-017-9829-3. Epub 2017 Nov 2.