Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAYELI8)

• DOT Name: RCC1 and BTB domain-containing protein 1 (RCBTB1)
• Synonyms: Chronic lymphocytic leukemia deletion region gene 7 protein; CLL deletion region gene 7 protein; Regulator of chromosome condensation and BTB domain-containing protein 1
• Gene Name: RCBTB1
• Related Disease:
  Coronary atherosclerosis
  Coronary heart disease
  Parkinson disease
  RCBTB1-related retinopathy
  Type-1 diabetes
  Acute myelogenous leukaemia
  Acute myocardial infarction
  Alzheimer disease
  Amyloidosis
  Arteriosclerosis
  Atherosclerosis
  Bipolar disorder
  Bone osteosarcoma
  Cardiovascular disease
  Chronic kidney disease
  Cognitive impairment
  Diabetic kidney disease
  Diabetic retinopathy
  Epithelial ovarian cancer
  Fatty liver disease
  Hyperglycemia
  Kleefstra syndrome
  Kleefstra syndrome 1
  Nephropathy
  Non-alcoholic fatty liver disease
  Obesity
  Osteoporosis
  Osteosarcoma
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic tumour
  Retinitis pigmentosa
  Retinopathy
  Schizophrenia
  Small lymphocytic lymphoma
  Stroke
  leukaemia
  Leukemia
  Neoplasm
  Type-1/2 diabetes
  Reticular dystrophy of the retinal pigment epithelium
  Pancreatic cancer
  Cardiomyopathy
  Chronic renal failure
  Exudative vitreoretinopathy
  Hepatitis
  Myocardial infarction
  Pancreatitis
• UniProt ID: RCBT1_HUMAN
• Pfam ID: PF00651 ; PF00415
• Sequence:
  MVDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQ
  STLVPKKLEGLCGKKIKSLSYGSGPHVLLSTEDGVVYAWGHNGYSQLGNGTTNQGIAPVQ
  VCTNLLIKQVVEVACGSHHSMALAADGEVFAWGYNNCGQVGSGSTANQPTPRKVTNCLHI
  KRVVGIACGQTSSMAVLDNGEVYGWGYNGNGQLGLGNNGNQLTPVRVAALHSVCVNQIVC
  GYAHTLALTDEGLLYAWGANTYGQLGTGNKNNLLSPAHIMVEKERVVEIAACHSAHTSAA
  KTQGGHVYMWGQCRGQSVILPHLTHFSCTDDVFACFATPAVSWRLLSVEHEDFLTVAESL
  KKEFDSPETADLKFRIDGKYIHVHKAVLKIRCEHFRSMFQSYWNEDMKEVIEIDQFSYPV
  YRAFLQYLYTDTVDLPPEDAIGLLDLATSYCENRLKKLCQHIIKRGITVENAFSLFSAAV
  RYDAEDLEEFCFKFCINHLTEVTQTAAFWQMDGPLLKEFIAKASKCGAFKN
• Function: May be involved in cell cycle regulation by chromatin remodeling.
• Tissue Specificity: Ubiquitously expressed . In the retina, present in the nerve fiber layer and to a lesser extent in the inner and outer plexiform layers (at protein level) .

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Coronary atherosclerosis	DISKNDYU	Definitive	Genetic Variation	[1]
Coronary heart disease	DIS5OIP1	Definitive	Genetic Variation	[1]
Parkinson disease	DISQVHKL	Definitive	Biomarker	[2]
RCBTB1-related retinopathy	DISHZJ3D	Definitive	Autosomal recessive	[3]
Type-1 diabetes	DIS7HLUB	Definitive	Biomarker	[4]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[5]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[6]
Alzheimer disease	DISF8S70	Strong	Biomarker	[7]
Amyloidosis	DISHTAI2	Strong	Biomarker	[8]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[9]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[9]
Bipolar disorder	DISAM7J2	Strong	Genetic Variation	[10]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[11]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[12]
Chronic kidney disease	DISW82R7	Strong	Biomarker	[13]
Cognitive impairment	DISH2ERD	Strong	Biomarker	[14]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[15]
Diabetic retinopathy	DISHGUJM	Strong	Biomarker	[16]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[17]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[18]
Hyperglycemia	DIS0BZB5	Strong	Biomarker	[19]
Kleefstra syndrome	DISHH9SN	Strong	Genetic Variation	[20]
Kleefstra syndrome 1	DISNODDM	Strong	Genetic Variation	[20]
Nephropathy	DISXWP4P	Strong	Genetic Variation	[21]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[22]
Obesity	DIS47Y1K	Strong	Biomarker	[23]
Osteoporosis	DISF2JE0	Strong	Biomarker	[24]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[11]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[17]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[17]
Pancreatic tumour	DIS3U0LK	Strong	Biomarker	[25]
Retinitis pigmentosa	DISCGPY8	Strong	Genetic Variation	[26]
Retinopathy	DISB4B0F	Strong	Genetic Variation	[27]
Schizophrenia	DISSRV2N	Strong	Biomarker	[28]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[29]
Stroke	DISX6UHX	Strong	Genetic Variation	[30]
leukaemia	DISS7D1V	moderate	Biomarker	[31]
Leukemia	DISNAKFL	moderate	Biomarker	[31]
Neoplasm	DISZKGEW	moderate	Biomarker	[32]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[33]
Reticular dystrophy of the retinal pigment epithelium	DIS2LN29	Supportive	Autosomal recessive	[26]
Pancreatic cancer	DISJC981	Disputed	Genetic Variation	[34]
Cardiomyopathy	DISUPZRG	Limited	Posttranslational Modification	[35]
Chronic renal failure	DISGG7K6	Limited	Biomarker	[36]
Exudative vitreoretinopathy	DISWN0TG	Limited	Autosomal dominant	[37]
Hepatitis	DISXXX35	Limited	Biomarker	[38]
Myocardial infarction	DIS655KI	Limited	Genetic Variation	[30]
Pancreatitis	DIS0IJEF	Limited	Genetic Variation	[39]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitoxantrone	DMM39BF	Approved	RCC1 and BTB domain-containing protein 1 (RCBTB1) affects the response to substance of Mitoxantrone.	[50]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of RCC1 and BTB domain-containing protein 1 (RCBTB1).	[40]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of RCC1 and BTB domain-containing protein 1 (RCBTB1).	[41]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of RCC1 and BTB domain-containing protein 1 (RCBTB1).	[42]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of RCC1 and BTB domain-containing protein 1 (RCBTB1).	[43]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of RCC1 and BTB domain-containing protein 1 (RCBTB1).	[44]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of RCC1 and BTB domain-containing protein 1 (RCBTB1).	[46]
Fluoxetine	DM3PD2C	Approved	Fluoxetine increases the expression of RCC1 and BTB domain-containing protein 1 (RCBTB1).	[47]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of RCC1 and BTB domain-containing protein 1 (RCBTB1).	[49]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of RCC1 and BTB domain-containing protein 1 (RCBTB1).	[45]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of RCC1 and BTB domain-containing protein 1 (RCBTB1).	[48]

References

• [1] Polymorphisms in the Glucagon-Like Peptide 1 Receptor (GLP-1R) Gene Are Associated with the Risk of Coronary Artery Disease in Chinese Han Patients with Type 2 Diabetes Mellitus: A Case-Control Study.J Diabetes Res. 2018 Sep 9;2018:1054192. doi: 10.1155/2018/1054192. eCollection 2018.
• [2] Sodium butyrate exerts protective effect against Parkinson's disease in mice via stimulation of glucagon like peptide-1.J Neurol Sci. 2017 Oct 15;381:176-181. doi: 10.1016/j.jns.2017.08.3235. Epub 2017 Aug 24.
• [3] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [4] Addition of glucagon-like peptide-1 receptor agonist therapy to insulin in C-peptide-positive patients with type 1 diabetes.Diabetes Obes Metab. 2019 Apr;21(4):1054-1057. doi: 10.1111/dom.13609. Epub 2019 Jan 8.
• [5] Genome-wide mapping of histone H3K9me2 in acute myeloid leukemia reveals large chromosomal domains associated with massive gene silencing and sites of genome instability.PLoS One. 2017 Mar 16;12(3):e0173723. doi: 10.1371/journal.pone.0173723. eCollection 2017.
• [6] Association of glucagon-like peptide-1 receptor agonist use and rates of acute myocardial infarction, stroke and overall mortality in patients with type 2 diabetes mellitus in a large integrated health system.Diabetes Obes Metab. 2017 Nov;19(11):1555-1561. doi: 10.1111/dom.12969. Epub 2017 Jul 5.
• [7] Pharmacological inhibition of G9a/GLP restores cognition and reduces oxidative stress, neuroinflammation and -Amyloid plaques in an early-onset Alzheimer's disease mouse model.Aging (Albany NY). 2019 Dec 4;11(23):11591-11608. doi: 10.18632/aging.102558. Epub 2019 Dec 4.
• [8] Evidence of metabolic memory-induced neurodegeneration and the therapeutic effects of glucagon-like peptide-1 receptor agonists via Forkhead box class O.Biochim Biophys Acta Mol Basis Dis. 2019 Feb 1;1865(2):371-377. doi: 10.1016/j.bbadis.2018.11.012. Epub 2018 Nov 20.
• [9] Liraglutide Attenuates Preestablished Atherosclerosis in Apolipoprotein E-Deficient Mice via Regulation of Immune Cell Phenotypes and Proinflammatory Mediators.J Pharmacol Exp Ther. 2019 Sep;370(3):447-458. doi: 10.1124/jpet.119.258343. Epub 2019 Jul 3.
• [10] Targeted lipidomics reveal derangement of ceramides in major depression and bipolar disorder.Metabolism. 2019 Jun;95:65-76. doi: 10.1016/j.metabol.2019.04.002. Epub 2019 Apr 5.
• [11] Clld7, a candidate tumor suppressor on chromosome 13q14, regulates pathways of DNA damage/repair and apoptosis.Cancer Res. 2010 Nov 15;70(22):9434-43. doi: 10.1158/0008-5472.CAN-10-1960. Epub 2010 Oct 5.
• [12] Series: Implications of the recent CVOTs in type 2 diabetes: Impact on guidelines: The endocrinologist point of view.Diabetes Res Clin Pract. 2020 Jan;159:107726. doi: 10.1016/j.diabres.2019.05.005. Epub 2019 May 18.
• [13] Review of glucagon-like peptide-1 receptor agonists for the treatment of type 2 diabetes mellitus in patients with chronic kidney disease and their renal effects.J Diabetes. 2019 Dec;11(12):938-948. doi: 10.1111/1753-0407.12969. Epub 2019 Aug 14.
• [14] Epigenetics and memory: Emerging role of histone lysine methyltransferase G9a/GLP complex as bidirectional regulator of synaptic plasticity.Neurobiol Learn Mem. 2019 Mar;159:1-5. doi: 10.1016/j.nlm.2019.01.013. Epub 2019 Jan 28.
• [15] GLP-1 receptor agonists for prevention of cardiorenal outcomes in type 2 diabetes: An updated meta-analysis including the REWIND and PIONEER 6 trials.Diabetes Obes Metab. 2019 Nov;21(11):2576-2580. doi: 10.1111/dom.13847. Epub 2019 Aug 28.
• [16] Glucagon-like Peptide 1 Receptor Agonists, Diabetic Retinopathy and Angiogenesis: The AngioSafe Type 2 Diabetes Study.J Clin Endocrinol Metab. 2020 Apr 1;105(4):dgz069. doi: 10.1210/clinem/dgz069.
• [17] FIH Is an Oxygen Sensor in Ovarian Cancer for G9a/GLP-Driven Epigenetic Regulation of Metastasis-Related Genes.Cancer Res. 2018 Mar 1;78(5):1184-1199. doi: 10.1158/0008-5472.CAN-17-2506. Epub 2017 Dec 19.
• [18] Efficacy and safety of glucagon-like peptide-1 receptor agonists in non-alcoholic fatty liver disease: A systematic review and meta-analysis.Clin Res Hepatol Gastroenterol. 2017 Jun;41(3):284-295. doi: 10.1016/j.clinre.2016.11.009. Epub 2017 Jan 5.
• [19] Emerging glucose-lowering therapies: a guide for cardiologists.Heart. 2020 Jan;106(1):18-23. doi: 10.1136/heartjnl-2019-315758. Epub 2019 Sep 24.
• [20] Biochemical validation of EHMT1 missense mutations in Kleefstra syndrome.J Hum Genet. 2018 May;63(5):555-562. doi: 10.1038/s10038-018-0413-3. Epub 2018 Feb 19.
• [21] Erratum to: Microvascular effects of glucagon-like peptide-1 receptor agonists in type 2 diabetes: a meta-analysis of randomized controlled trials.Acta Diabetol. 2017 Nov;54(11):1069-1071. doi: 10.1007/s00592-017-1049-z.
• [22] Inhibition of microRNA-124a attenuates non-alcoholic fatty liver disease through upregulation of adipose triglyceride lipase and the effect of liraglutide intervention.Hepatol Res. 2019 Jul;49(7):743-757. doi: 10.1111/hepr.13330. Epub 2019 Apr 17.
• [23] An evaluation of liraglutide including its efficacy and safety for the treatment of obesity.Expert Opin Pharmacother. 2020 Feb;21(3):275-285. doi: 10.1080/14656566.2019.1695779. Epub 2019 Dec 2.
• [24] Novel skeletal effects of glucagon-like peptide-1 (GLP-1) receptor agonists.J Endocrinol. 2018 Jan;236(1):R29-R42. doi: 10.1530/JOE-17-0278. Epub 2017 Aug 30.
• [25] GLP-1 receptor agonists and risk of cancer in type 2 diabetes: an updated meta-analysis of randomized controlled trials.Endocrine. 2019 Nov;66(2):157-165. doi: 10.1007/s12020-019-02055-z. Epub 2019 Aug 16.
• [26] Isolated and Syndromic Retinal Dystrophy Caused by Biallelic Mutations in RCBTB1, a Gene Implicated in Ubiquitination. Am J Hum Genet. 2016 Aug 4;99(2):470-80. doi: 10.1016/j.ajhg.2016.06.017.
• [27] Glucagon-like peptide-1 receptor agonists are not associated with retinal adverse events in the FDA Adverse Event Reporting System.BMJ Open Diabetes Res Care. 2018 Jan 30;6(1):e000475. doi: 10.1136/bmjdrc-2017-000475. eCollection 2018.
• [28] Glucagon-like peptide-1 receptor agonists for antipsychotic-associated cardio-metabolic risk factors: A systematic review and individual participant data meta-analysis.Diabetes Obes Metab. 2019 Feb;21(2):293-302. doi: 10.1111/dom.13522. Epub 2018 Oct 7.
• [29] GLP overexpression is associated with poor prognosis in Chronic Lymphocytic Leukemia and its inhibition induces leukemic cell death.Invest New Drugs. 2018 Oct;36(5):955-960. doi: 10.1007/s10637-018-0613-x. Epub 2018 May 31.
• [30] Navigating the "MACE" in Cardiovascular Outcomes Trials and decoding the relevance of Atherosclerotic Cardiovascular Disease benefits versus Heart Failure benefits.Diabetes Obes Metab. 2019 Aug;21(8):1780-1789. doi: 10.1111/dom.13740. Epub 2019 Apr 29.
• [31] The Histone Methyltransferase Inhibitor A-366 Uncovers a Role for G9a/GLP in the Epigenetics of Leukemia.PLoS One. 2015 Jul 6;10(7):e0131716. doi: 10.1371/journal.pone.0131716. eCollection 2015.
• [32] Critical review of renal tubule karyomegaly in non-clinical safety evaluation studies and its significance for human risk assessment.Crit Rev Toxicol. 2018 Aug;48(7):575-595. doi: 10.1080/10408444.2018.1503641. Epub 2018 Oct 2.
• [33] A Review on the Effects of New Anti-Diabetic Drugs on Platelet Function.Endocr Metab Immune Disord Drug Targets. 2020;20(3):328-334. doi: 10.2174/1871530319666191014110414.
• [34] Treatment with incretins does not increase the risk of pancreatic diseases compared to older anti-hyperglycaemic drugs, when added to metformin: real world evidence in people with Type 2 diabetes.Diabet Med. 2019 Apr;36(4):491-498. doi: 10.1111/dme.13835. Epub 2018 Oct 25.
• [35] Epigenetic response to environmental stress: Assembly of BRG1-G9a/GLP-DNMT3 repressive chromatin complex on Myh6 promoter in pathologically stressed hearts.Biochim Biophys Acta. 2016 Jul;1863(7 Pt B):1772-81. doi: 10.1016/j.bbamcr.2016.03.002. Epub 2016 Mar 4.
• [36] Effects of glucose-lowering agents on surrogate endpoints and hard clinical renal outcomes in patients with type 2 diabetes.Diabetes Metab. 2019 Apr;45(2):110-121. doi: 10.1016/j.diabet.2018.10.003. Epub 2018 Oct 25.
• [37] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [38] Future Perspectives on GLP-1 Receptor Agonists and GLP-1/glucagon Receptor Co-agonists in the Treatment of NAFLD.Front Endocrinol (Lausanne). 2018 Nov 6;9:649. doi: 10.3389/fendo.2018.00649. eCollection 2018.
• [39] Pancreatitis Incidence in the Exenatide BID, Exenatide QW, and Exenatide QW Suspension Development Programs: Pooled Analysis of 35 Clinical Trials.Diabetes Ther. 2019 Aug;10(4):1249-1270. doi: 10.1007/s13300-019-0627-1. Epub 2019 May 10.
• [40] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [41] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [42] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [43] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [44] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [45] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [46] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [47] Screening autism-associated environmental factors in differentiating human neural progenitors with fractional factorial design-based transcriptomics. Sci Rep. 2023 Jun 29;13(1):10519. doi: 10.1038/s41598-023-37488-0.
• [48] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [49] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [50] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.