Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB1KWJS)

• DOT Name: Alpha-enolase (ENO1)
• Synonyms: EC 4.2.1.11; 2-phospho-D-glycerate hydro-lyase; C-myc promoter-binding protein; Enolase 1; MBP-1; MPB-1; Non-neural enolase; NNE; Phosphopyruvate hydratase; Plasminogen-binding protein
• Gene Name: ENO1
• Related Disease:
  Lung adenocarcinoma
  Neuroblastoma
  Stomach cancer
  Adenocarcinoma
  Advanced cancer
  Alzheimer disease
  Arthritis
  Behcet disease
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Clear cell renal carcinoma
  Colorectal carcinoma
  Esophageal cancer
  Familial Alzheimer disease
  Gastric cancer
  Gastric neoplasm
  Hepatocellular carcinoma
  Hereditary diffuse gastric adenocarcinoma
  Male infertility
  Neoplasm
  Neoplasm of esophagus
  Non-small-cell lung cancer
  Osteoarthritis
  Osteoporosis
  Prostate neoplasm
  Autoimmune disease
  Squamous cell carcinoma
  High blood pressure
  Acute coronary syndrome
  Carcinoma
  Lung cancer
  Lung carcinoma
  Matthew-Wood syndrome
  Non-insulin dependent diabetes
  Pancreatic cancer
  Prostate cancer
  Prostate carcinoma
  Undifferentiated carcinoma
• UniProt ID: ENOA_HUMAN
• PDB ID: 2PSN; 3B97; 5JLZ; 5LAX; 5NI9; 5NIG; 5OCK
• EC Number: 4.2.1.11
• Pfam ID: PF00113 ; PF03952
• Sequence:
  MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGK
  GVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCK
  AGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFRE
  AMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKV
  VIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD
  WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLA
  QANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK
  AKFAGRNFRNPLAK
• Function: Glycolytic enzyme the catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate. In addition to glycolysis, involved in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production ; [Isoform MBP-1]: Binds to the myc promoter and acts as a transcriptional repressor. May be a tumor suppressor.
• Tissue Specificity: The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
• KEGG Pathway:
  Glycolysis / Gluconeogenesis (hsa00010)
  Metabolic pathways (hsa01100)
  Carbon metabolism (hsa01200)
  Biosynthesis of amino acids (hsa01230)
  R. degradation (hsa03018)
  HIF-1 sig.ling pathway (hsa04066)
  Cytoskeleton in muscle cells (hsa04820)
• Reactome Pathway:
  Gluconeogenesis (R-HSA-70263)
  Manipulation of host energy metabolism (R-HSA-9636667)
  Glycolysis (R-HSA-70171)
• BioCyc Pathway: MetaCyc:ENSG00000074800-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Definitive	Biomarker	[1]
Neuroblastoma	DISVZBI4	Definitive	Altered Expression	[2]
Stomach cancer	DISKIJSX	Definitive	Biomarker	[3]
Adenocarcinoma	DIS3IHTY	Strong	Genetic Variation	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Biomarker	[6]
Arthritis	DIST1YEL	Strong	Biomarker	[7]
Behcet disease	DISSYMBS	Strong	Biomarker	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[9]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[11]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[12]
Familial Alzheimer disease	DISE75U4	Strong	Biomarker	[6]
Gastric cancer	DISXGOUK	Strong	Biomarker	[3]
Gastric neoplasm	DISOKN4Y	Strong	Biomarker	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[14]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Strong	Biomarker	[13]
Male infertility	DISY3YZZ	Strong	Biomarker	[15]
Neoplasm	DISZKGEW	Strong	Biomarker	[16]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[12]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[17]
Osteoarthritis	DIS05URM	Strong	Biomarker	[18]
Osteoporosis	DISF2JE0	Strong	Biomarker	[19]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[20]
Autoimmune disease	DISORMTM	moderate	Biomarker	[21]
Squamous cell carcinoma	DISQVIFL	moderate	Altered Expression	[22]
High blood pressure	DISY2OHH	Disputed	Biomarker	[23]
Acute coronary syndrome	DIS7DYEW	Limited	Biomarker	[24]
Carcinoma	DISH9F1N	Limited	Biomarker	[25]
Lung cancer	DISCM4YA	Limited	Altered Expression	[26]
Lung carcinoma	DISTR26C	Limited	Altered Expression	[26]
Matthew-Wood syndrome	DISA7HR7	Limited	Altered Expression	[27]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[28]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[29]
Prostate cancer	DISF190Y	Limited	Biomarker	[20]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[20]
Undifferentiated carcinoma	DISIAZST	Limited	Biomarker	[25]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Afimoxifene	DMFORDT	Phase 2	Alpha-enolase (ENO1) decreases the response to substance of Afimoxifene.	[69]

35 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Alpha-enolase (ENO1).	[30]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Alpha-enolase (ENO1).	[31]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Alpha-enolase (ENO1).	[32]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Alpha-enolase (ENO1).	[33]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Alpha-enolase (ENO1).	[34]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Alpha-enolase (ENO1).	[35]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Alpha-enolase (ENO1).	[36]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the activity of Alpha-enolase (ENO1).	[37]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Alpha-enolase (ENO1).	[38]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Alpha-enolase (ENO1).	[39]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Alpha-enolase (ENO1).	[40]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Alpha-enolase (ENO1).	[41]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone affects the expression of Alpha-enolase (ENO1).	[42]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Alpha-enolase (ENO1).	[43]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of Alpha-enolase (ENO1).	[44]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Alpha-enolase (ENO1).	[45]
Fenofibrate	DMFKXDY	Approved	Fenofibrate increases the expression of Alpha-enolase (ENO1).	[46]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of Alpha-enolase (ENO1).	[46]
Benzatropine	DMF7EXL	Approved	Benzatropine decreases the expression of Alpha-enolase (ENO1).	[47]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Alpha-enolase (ENO1).	[48]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Alpha-enolase (ENO1).	[48]
Liothyronine	DM6IR3P	Approved	Liothyronine increases the expression of Alpha-enolase (ENO1).	[49]
Etretinate	DM2CZFA	Approved	Etretinate decreases the expression of Alpha-enolase (ENO1).	[51]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Alpha-enolase (ENO1).	[52]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Alpha-enolase (ENO1).	[53]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Alpha-enolase (ENO1).	[54]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Alpha-enolase (ENO1).	[55]
Tanespimycin	DMNLQHK	Phase 2	Tanespimycin increases the expression of Alpha-enolase (ENO1).	[56]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Alpha-enolase (ENO1).	[59]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Alpha-enolase (ENO1).	[61]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Alpha-enolase (ENO1).	[62]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Alpha-enolase (ENO1).	[63]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Alpha-enolase (ENO1).	[64]
AHPN	DM8G6O4	Investigative	AHPN decreases the expression of Alpha-enolase (ENO1).	[67]
Paraoxon	DMN4ZKC	Investigative	Paraoxon decreases the expression of Alpha-enolase (ENO1).	[68]

3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin affects the binding of Alpha-enolase (ENO1).	[50]
D-glucose	DMMG2TO	Investigative	D-glucose decreases the secretion of Alpha-enolase (ENO1).	[65]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal affects the binding of Alpha-enolase (ENO1).	[6]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Alpha-enolase (ENO1).	[57]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Alpha-enolase (ENO1).	[58]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Alpha-enolase (ENO1).	[60]

References

• [1] Neuron-Specific Enolase Is an Independent Prognostic Factor in Resected Lung Adenocarcinoma Patients with Anaplastic Lymphoma Kinase Gene Rearrangements.Med Sci Monit. 2019 Jan 23;25:675-690. doi: 10.12659/MSM.913054.
• [2] Introduction of in vitro transcribed ENO1 mRNA into neuroblastoma cells induces cell death.BMC Cancer. 2005 Dec 16;5:161. doi: 10.1186/1471-2407-5-161.
• [3] Gene expression profile analysis of ENO1 knockdown in gastric cancer cell line MGC-803.Oncol Lett. 2019 Apr;17(4):3881-3889. doi: 10.3892/ol.2019.10053. Epub 2019 Feb 19.
• [4] Genetic polymorphisms in glycolytic pathway are associated with the prognosis of patients with early stage non-small cell lung cancer.Sci Rep. 2016 Oct 21;6:35603. doi: 10.1038/srep35603.
• [5] Acetonitrile-assisted enzymatic digestion can facilitate the bottom-up identification of proteins of cancer origin.Anal Biochem. 2019 Apr 1;570:1-4. doi: 10.1016/j.ab.2019.01.004. Epub 2019 Jan 17.
• [6] Proteomic identification of HNE-bound proteins in early Alzheimer disease: Insights into the role of lipid peroxidation in the progression of AD. Brain Res. 2009 Jun 5;1274:66-76. doi: 10.1016/j.brainres.2009.04.009. Epub 2009 Apr 15.
• [7] Effects of B-cell directed therapy on the preclinical stage of rheumatoid arthritis: the PRAIRI study.Ann Rheum Dis. 2019 Feb;78(2):179-185. doi: 10.1136/annrheumdis-2017-212763. Epub 2018 Dec 1.
• [8] Anti-alpha-enolase antibodies in Behet's disease: a marker of mucocutaneous and articular disease activity?.Clin Exp Rheumatol. 2018 Nov-Dec;36(6 Suppl 115):28-32. Epub 2018 Feb 7.
• [9] Expression of Alpha-Enolase (ENO1), Myc Promoter-Binding Protein-1 (MBP-1) and Matrix Metalloproteinases (MMP-2 and MMP-9) Reflect the Nature and Aggressiveness of Breast Tumors.Int J Mol Sci. 2019 Aug 14;20(16):3952. doi: 10.3390/ijms20163952.
• [10] Identification of Novel Proteins Interacting with Vascular Endothelial Growth Inhibitor 174 in Renal Cell Carcinoma.Anticancer Res. 2017 Aug;37(8):4379-4388. doi: 10.21873/anticanres.11832.
• [11] -enolase promotes tumorigenesis and metastasis via regulating AMPK/mTOR pathway in colorectal cancer.Mol Carcinog. 2017 May;56(5):1427-1437. doi: 10.1002/mc.22603. Epub 2017 Jan 12.
• [12] Comparative proteomic analysis of esophageal squamous cell carcinoma.Proteomics. 2005 Jul;5(11):2960-71. doi: 10.1002/pmic.200401175.
• [13] Diverse proteomic alterations in gastric adenocarcinoma.Proteomics. 2004 Oct;4(10):3276-87. doi: 10.1002/pmic.200300916.
• [14] Targetting an LncRNA P5848-ENO1 axis inhibits tumor growth in hepatocellular carcinoma.Biosci Rep. 2019 Nov 29;39(11):BSR20180896. doi: 10.1042/BSR20180896.
• [15] Comparative proteomics reveals the underlying toxicological mechanism of low sperm motility induced by iron ion radiation in mice.Reprod Toxicol. 2016 Oct;65:148-158. doi: 10.1016/j.reprotox.2016.07.014. Epub 2016 Jul 25.
• [16] CircRNA-ENO1 promoted glycolysis and tumor progression in lung adenocarcinoma through upregulating its host gene ENO1.Cell Death Dis. 2019 Nov 25;10(12):885. doi: 10.1038/s41419-019-2127-7.
• [17] Serological proteome analysis approach-based identification of ENO1 as a tumor-associated antigen and its autoantibody could enhance the sensitivity of CEA and CYFRA 21-1 in the detection of non-small cell lung cancer.Oncotarget. 2017 May 30;8(22):36664-36673. doi: 10.18632/oncotarget.17067.
• [18] Association of Distinct Fine Specificities of Anti-Citrullinated Peptide Antibodies With Elevated Immune Responses to Prevotella intermedia in a Subgroup of Patients With Rheumatoid Arthritis and Periodontitis.Arthritis Rheumatol. 2017 Dec;69(12):2303-2313. doi: 10.1002/art.40227. Epub 2017 Oct 30.
• [19] Proteomic analysis of circulating monocytes in Chinese premenopausal females with extremely discordant bone mineral density.Proteomics. 2008 Oct;8(20):4259-72. doi: 10.1002/pmic.200700480.
• [20] Knockdown of MBP-1 in human prostate cancer cells delays cell cycle progression.J Biol Chem. 2006 Aug 18;281(33):23652-7. doi: 10.1074/jbc.M602930200. Epub 2006 Jun 8.
• [21] Serum level of anti--enolase antibody in untreated systemic lupus erythematosus patients correlates with 24-hour urine protein and D-dimer.Lupus. 2018 Jan;27(1):139-142. doi: 10.1177/0961203317721752. Epub 2017 Jul 20.
• [22] Differential expression of the human alpha-enolase gene in oral epithelium and squamous cell carcinoma.Cancer Sci. 2007 Apr;98(4):499-505. doi: 10.1111/j.1349-7006.2007.00411.x. Epub 2007 Jan 31.
• [23] Differential protein expression in hypertrophic heart with and without hypertension in spontaneously hypertensive rats.Proteomics. 2006 Mar;6(6):1948-56. doi: 10.1002/pmic.200500337.
• [24] Proteomic changes related to "bewildered" circulating platelets in the acute coronary syndrome.Proteomics. 2011 Aug;11(16):3335-48. doi: 10.1002/pmic.201000708. Epub 2011 Jul 14.
• [25] cDNA microarray profiling of rat mammary gland carcinomas induced by 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine and 7,12-dimethylbenz[a]anthracene.Carcinogenesis. 2002 Oct;23(10):1561-8. doi: 10.1093/carcin/23.10.1561.
• [26] Diagnostic value of -enolase expression and serum -enolase autoantibody levels in lung cancer.J Bras Pneumol. 2018 Jan-Feb;44(1):18-23. doi: 10.1590/S1806-37562016000000241.
• [27] ENO1 silencing impaires hypoxia-induced gemcitabine chemoresistance associated with redox modulation in pancreatic cancer cells.Am J Transl Res. 2019 Jul 15;11(7):4470-4480. eCollection 2019.
• [28] When Place Matters: Shuttling of Enolase-1 Across Cellular Compartments.Front Cell Dev Biol. 2019 Apr 26;7:61. doi: 10.3389/fcell.2019.00061. eCollection 2019.
• [29] ENO1 Overexpression in Pancreatic Cancer Patients and Its Clinical and Diagnostic Significance.Gastroenterol Res Pract. 2018 Feb 1;2018:3842198. doi: 10.1155/2018/3842198. eCollection 2018.
• [30] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [31] Proteomics investigations of drug-induced hepatotoxicity in HepG2 cells. Toxicol Sci. 2011 Mar;120(1):109-22.
• [32] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [33] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [34] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [35] Nucleophosmin in the pathogenesis of arsenic-related bladder carcinogenesis revealed by quantitative proteomics. Toxicol Appl Pharmacol. 2010 Jan 15;242(2):126-35. doi: 10.1016/j.taap.2009.09.016. Epub 2009 Oct 7.
• [36] Differential protein expression of peroxiredoxin I and II by benzo(a)pyrene and quercetin treatment in 22Rv1 and PrEC prostate cell lines. Toxicol Appl Pharmacol. 2007 Apr 15;220(2):197-210. doi: 10.1016/j.taap.2006.12.030. Epub 2007 Jan 9.
• [37] Oxidative modifications of proteins by sodium arsenite in human umbilical vein endothelial cells. Environ Toxicol. 2011 Oct;26(5):459-71. doi: 10.1002/tox.20572. Epub 2010 Mar 1.
• [38] Proteomic analysis revealed association of aberrant ROS signaling with suberoylanilide hydroxamic acid-induced autophagy in Jurkat T-leukemia cells. Autophagy. 2010 Aug;6(6):711-24. doi: 10.4161/auto.6.6.12397. Epub 2010 Aug 17.
• [39] Proteomic identification of differentially expressed proteins associated with the multiple drug resistance in methotrexate-resistant human breast cancer cells. Int J Oncol. 2014 Jul;45(1):448-58.
• [40] Gene induction and apoptosis in human hepatocellular carci-noma cells SMMC-7721 exposed to 5-aza-2'-deoxycytidine. Chin Med J (Engl). 2007 Sep 20;120(18):1626-31.
• [41] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [42] Proteomic analysis of human adipose tissue after rosiglitazone treatment shows coordinated changes to promote glucose uptake. Obesity (Silver Spring). 2010 Jan;18(1):27-34. doi: 10.1038/oby.2009.208. Epub 2009 Jun 25.
• [43] Effects of acute ethanol treatment on NCCIT cells and NCCIT cell-derived embryoid bodies (EBs). Toxicol In Vitro. 2010 Sep;24(6):1696-704. doi: 10.1016/j.tiv.2010.05.017. Epub 2010 May 26.
• [44] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [45] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [46] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [47] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [48] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [49] Thyroid hormone responsive genes in cultured human fibroblasts. J Clin Endocrinol Metab. 2005 Feb;90(2):936-43.
• [50] Untargeted Proteomics and Systems-Based Mechanistic Investigation of Artesunate in Human Bronchial Epithelial Cells. Chem Res Toxicol. 2015 Oct 19;28(10):1903-13. doi: 10.1021/acs.chemrestox.5b00105. Epub 2015 Sep 21.
• [51] Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
• [52] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [53] Resveratrol-induced cell growth inhibition and apoptosis is associated with modulation of phosphoglycerate mutase B in human prostate cancer cells: two-dimensional sodium dodecyl sulfate-polyacrylamide gel electrophoresis and mass spectrometry evaluation. Cancer Detect Prev. 2004;28(6):443-52. doi: 10.1016/j.cdp.2004.08.009.
• [54] Curcumin inhibits hypoxia-inducible factor-1 by degrading aryl hydrocarbon receptor nuclear translocator: a mechanism of tumor growth inhibition. Mol Pharmacol. 2006 Nov;70(5):1664-71. doi: 10.1124/mol.106.025817. Epub 2006 Jul 31.
• [55] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [56] Impact of Heat Shock Protein 90 Inhibition on the Proteomic Profile of Lung Adenocarcinoma as Measured by Two-Dimensional Electrophoresis Coupled with Mass Spectrometry. Cells. 2019 Jul 31;8(8):806. doi: 10.3390/cells8080806.
• [57] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [58] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [59] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [60] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [61] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [62] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [63] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [64] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [65] Calorie restriction-induced changes in the secretome of human adipocytes, comparison with resveratrol-induced secretome effects. Biochim Biophys Acta. 2014 Sep;1844(9):1511-22. doi: 10.1016/j.bbapap.2014.04.023. Epub 2014 May 5.
• [66] Proteomic identification of HNE-bound proteins in early Alzheimer disease: Insights into the role of lipid peroxidation in the progression of AD. Brain Res. 2009 Jun 5;1274:66-76. doi: 10.1016/j.brainres.2009.04.009. Epub 2009 Apr 15.
• [67] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.
• [68] Paraoxon-induced protein expression changes to SH-SY5Y cells. Chem Res Toxicol. 2010 Nov 15;23(11):1656-62. doi: 10.1021/tx100192f. Epub 2010 Oct 8.
• [69] Increased expression of enolase alpha in human breast cancer confers tamoxifen resistance in human breast cancer cells. Breast Cancer Res Treat. 2010 Jun;121(3):539-53. doi: 10.1007/s10549-009-0492-0. Epub 2009 Aug 5.