Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBRPZL5)

• DOT Name: Musculin (MSC)
• Synonyms: Activated B-cell factor 1; ABF-1; Class A basic helix-loop-helix protein 22; bHLHa22
• Gene Name: MSC
• Related Disease:
  Chronic obstructive pulmonary disease
  Melanoma
  Multiple sclerosis
  Nervous system inflammation
  Prostate cancer
  Prostate carcinoma
  Acute liver failure
  Acute myocardial infarction
  Advanced cancer
  Alzheimer disease
  Amyotrophic lateral sclerosis
  Autoimmune disease
  B-cell neoplasm
  Bronchopulmonary dysplasia
  Colon cancer
  Colon carcinoma
  Crohn disease
  Cutaneous mastocytosis
  Epithelial ovarian cancer
  Female hypogonadism
  Hepatocellular carcinoma
  Idiopathic thrombocytopenic purpura
  Lung cancer
  Lung carcinoma
  Myocardial infarction
  Neoplasm
  Osteoarthritis
  Ovarian cancer
  Ovarian neoplasm
  Parkinson disease
  Plasma cell myeloma
  Polycystic ovarian syndrome
  Pulmonary fibrosis
  Rheumatoid arthritis
  Stroke
  Type-1/2 diabetes
  Acute myelogenous leukaemia
  Gastric cancer
  Glioma
  Metastatic malignant neoplasm
  Adult glioblastoma
  Glioblastoma multiforme
  Type-1 diabetes
  Arthritis
  Asthma
  Chromosomal disorder
  Colitis
  Obesity
  Stomach cancer
• UniProt ID: MUSC_HUMAN
• Pfam ID: PF00010
• Sequence:
  MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCA
  LGTAGSAEGCKRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARM
  RVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTW
  PFVVSGRPDSDTKEVSAANRLCGTTA
• Function: Transcription repressor capable of inhibiting the transactivation capability of TCF3/E47. May play a role in regulating antigen-dependent B-cell differentiation.
• Tissue Specificity: Expressed in lymphoid tissues, B-cell lines and activated B-cells.

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chronic obstructive pulmonary disease	DISQCIRF	Definitive	Biomarker	[1]
Melanoma	DIS1RRCY	Definitive	Biomarker	[2]
Multiple sclerosis	DISB2WZI	Definitive	Biomarker	[3]
Nervous system inflammation	DISB3X5A	Definitive	Biomarker	[4]
Prostate cancer	DISF190Y	Definitive	Biomarker	[5]
Prostate carcinoma	DISMJPLE	Definitive	Biomarker	[5]
Acute liver failure	DIS5EZKX	Strong	Biomarker	[6]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[7]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[8]
Alzheimer disease	DISF8S70	Strong	Biomarker	[9]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Biomarker	[10]
Autoimmune disease	DISORMTM	Strong	Biomarker	[11]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[12]
Bronchopulmonary dysplasia	DISO0BY5	Strong	Biomarker	[13]
Colon cancer	DISVC52G	Strong	Biomarker	[14]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[14]
Crohn disease	DIS2C5Q8	Strong	Biomarker	[15]
Cutaneous mastocytosis	DISLBZEF	Strong	Biomarker	[16]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[17]
Female hypogonadism	DISWASB4	Strong	Biomarker	[16]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[18]
Idiopathic thrombocytopenic purpura	DISFKGJU	Strong	Biomarker	[19]
Lung cancer	DISCM4YA	Strong	Biomarker	[20]
Lung carcinoma	DISTR26C	Strong	Biomarker	[20]
Myocardial infarction	DIS655KI	Strong	Biomarker	[21]
Neoplasm	DISZKGEW	Strong	Biomarker	[22]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[23]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[17]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[17]
Parkinson disease	DISQVHKL	Strong	Biomarker	[24]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[25]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[26]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[27]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[28]
Stroke	DISX6UHX	Strong	Biomarker	[29]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[30]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[31]
Gastric cancer	DISXGOUK	moderate	Biomarker	[32]
Glioma	DIS5RPEH	moderate	Biomarker	[12]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[33]
Adult glioblastoma	DISVP4LU	Disputed	Biomarker	[34]
Glioblastoma multiforme	DISK8246	Disputed	Biomarker	[34]
Type-1 diabetes	DIS7HLUB	Disputed	Biomarker	[35]
Arthritis	DIST1YEL	Limited	Biomarker	[36]
Asthma	DISW9QNS	Limited	Biomarker	[37]
Chromosomal disorder	DISM5BB5	Limited	Biomarker	[38]
Colitis	DISAF7DD	Limited	Biomarker	[39]
Obesity	DIS47Y1K	Limited	Biomarker	[40]
Stomach cancer	DISKIJSX	Limited	Biomarker	[32]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Musculin (MSC).	[41]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Musculin (MSC).	[42]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Musculin (MSC).	[43]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Musculin (MSC).	[44]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Musculin (MSC).	[45]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Musculin (MSC).	[46]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Musculin (MSC).	[49]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Musculin (MSC).	[47]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Musculin (MSC).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Musculin (MSC).	[47]

References

• [1] Mesenchymal stem cells alleviate oxidative stress-induced mitochondrial dysfunction in the airways.J Allergy Clin Immunol. 2018 May;141(5):1634-1645.e5. doi: 10.1016/j.jaci.2017.08.017. Epub 2017 Sep 11.
• [2] New MSC: MSCs as pericytes are Sentinels and gatekeepers.J Orthop Res. 2017 Jun;35(6):1151-1159. doi: 10.1002/jor.23560. Epub 2017 Apr 11.
• [3] Immunomodulatory properties of MSC-derived exosomes armed with high affinity aptamer toward mylein as a platform for reducing multiple sclerosis clinical score.J Control Release. 2019 Apr 10;299:149-164. doi: 10.1016/j.jconrel.2019.02.032. Epub 2019 Feb 23.
• [4] Rapamycin Augments Immunomodulatory Properties of Bone Marrow-Derived Mesenchymal Stem Cells in Experimental Autoimmune Encephalomyelitis.Mol Neurobiol. 2017 May;54(4):2445-2457. doi: 10.1007/s12035-016-9840-3. Epub 2016 Mar 12.
• [5] BM-MSCs promote prostate cancer progression via the conversion of normal fibroblasts to cancer-associated fibroblasts.Int J Oncol. 2015 Aug;47(2):719-27. doi: 10.3892/ijo.2015.3060. Epub 2015 Jun 22.
• [6] Therapeutic effect of human umbilical cord blood mesenchymal stem cells combined with G-CSF on rats with acute liver failure.Biochem Biophys Res Commun. 2019 Oct 1;517(4):670-676. doi: 10.1016/j.bbrc.2019.07.101. Epub 2019 Aug 7.
• [7] Follistatin-like 1 protects mesenchymal stem cells from hypoxic damage and enhances their therapeutic efficacy in a mouse myocardial infarction model.Stem Cell Res Ther. 2019 Jan 11;10(1):17. doi: 10.1186/s13287-018-1111-y.
• [8] Long-term Evaluation of Allogeneic Bone Marrow-derived Mesenchymal Stromal Cell Therapy for Crohn's Disease Perianal Fistulas.J Crohns Colitis. 2020 Jan 1;14(1):64-70. doi: 10.1093/ecco-jcc/jjz116.
• [9] Intrahippocampal Transplantation of Undifferentiated Human Chorionic- Derived Mesenchymal Stem Cells Does Not Improve Learning and Memory in the Rat Model of Sporadic Alzheimer Disease.Curr Stem Cell Res Ther. 2019;14(2):184-190. doi: 10.2174/1574888X13666180723111249.
• [10] Reduced sirtuin 1/adenosine monophosphate-activated protein kinase in amyotrophic lateral sclerosis patient-derived mesenchymal stem cells can be restored by resveratrol.J Tissue Eng Regen Med. 2019 Jan;13(1):110-115. doi: 10.1002/term.2776. Epub 2018 Dec 10.
• [11] Human Herpes simplex 1 virus infection of endometrial decidual tissue-derived MSC alters HLA-G expression and immunosuppressive functions.Hum Immunol. 2018 Nov;79(11):800-808. doi: 10.1016/j.humimm.2018.08.006. Epub 2018 Aug 14.
• [12] Evaluation of Combination Treatment Effect With TRAIL-secreting Mesenchymal Stem Cells and Compound C Against Glioblastoma.Anticancer Res. 2019 Dec;39(12):6635-6643. doi: 10.21873/anticanres.13878.
• [13] Timing of erythropoietin modified mesenchymal stromal cell transplantation for the treatment of experimental bronchopulmonary dysplasia.J Cell Mol Med. 2018 Nov;22(11):5759-5763. doi: 10.1111/jcmm.13843. Epub 2018 Aug 30.
• [14] Exosomes from BM-MSCs increase the population of CSCs via transfer of miR-142-3p.Br J Cancer. 2018 Sep;119(6):744-755. doi: 10.1038/s41416-018-0254-z. Epub 2018 Sep 17.
• [15] MIS416 Enhances Therapeutic Functions of Human Umbilical Cord Blood-Derived Mesenchymal Stem Cells Against Experimental Colitis by Modulating Systemic Immune Milieu.Front Immunol. 2018 May 28;9:1078. doi: 10.3389/fimmu.2018.01078. eCollection 2018.
• [16] Human amnion-derived mesenchymal stem cell (hAD-MSC) transplantation improves ovarian function in rats with premature ovarian insufficiency (POI) at least partly through a paracrine mechanism.Stem Cell Res Ther. 2019 Jan 25;10(1):46. doi: 10.1186/s13287-019-1136-x.
• [17] Leukemia inhibitory factor functions in parallel with interleukin-6 to promote ovarian cancer growth.Oncogene. 2019 Feb;38(9):1576-1584. doi: 10.1038/s41388-018-0523-6. Epub 2018 Oct 10.
• [18] The Therapeutic Potential of Adipose Tissue-Derived Mesenchymal Stem Cells to Enhance Radiotherapy Effects on Hepatocellular Carcinoma.Front Cell Dev Biol. 2019 Nov 12;7:267. doi: 10.3389/fcell.2019.00267. eCollection 2019.
• [19] CB2 Receptor Stimulation and Dexamethasone Restore the Anti-Inflammatory and Immune-Regulatory Properties of Mesenchymal Stromal Cells of Children with Immune Thrombocytopenia.Int J Mol Sci. 2019 Feb 28;20(5):1049. doi: 10.3390/ijms20051049.
• [20] Extracellular vesicles secreted by hypoxia pre-challenged mesenchymal stem cells promote non-small cell lung cancer cell growth and mobility as well as macrophage M2 polarization via miR-21-5p delivery.J Exp Clin Cancer Res. 2019 Feb 8;38(1):62. doi: 10.1186/s13046-019-1027-0.
• [21] Effect of intravenous transplantation of hUCB-MSCs on M1/M2 subtype conversion in monocyte/macrophages of AMI mice.Biomed Pharmacother. 2019 Mar;111:624-630. doi: 10.1016/j.biopha.2018.12.095. Epub 2019 Jan 3.
• [22] Human colorectal cancer derived-MSCs promote tumor cells escape from senescence via P53/P21 pathway.Clin Transl Oncol. 2020 Apr;22(4):503-511. doi: 10.1007/s12094-019-02152-5. Epub 2019 Jun 19.
• [23] Icariin inhibits chondrocyte apoptosis and angiogenesis by regulating the TDP-43 signaling pathway.Mol Genet Genomic Med. 2019 Apr;7(4):e00586. doi: 10.1002/mgg3.586. Epub 2019 Feb 7.
• [24] Aging, rather than Parkinson's disease, affects the responsiveness of PBMCs to the immunosuppression of bone marrow mesenchymal stem cells.Mol Med Rep. 2019 Jan;19(1):165-176. doi: 10.3892/mmr.2018.9670. Epub 2018 Nov 19.
• [25] Mesenchymal stem cells gene signature in high-risk myeloma bone marrow linked to suppression of distinct IGFBP2-expressing small adipocytes.Br J Haematol. 2019 Feb;184(4):578-593. doi: 10.1111/bjh.15669. Epub 2018 Nov 8.
• [26] Mesenchymal Stem Cells Alleviate DHEA-Induced Polycystic Ovary Syndrome (PCOS) by Inhibiting Inflammation in Mice.Stem Cells Int. 2019 Sep 12;2019:9782373. doi: 10.1155/2019/9782373. eCollection 2019.
• [27] Transplantation of adipose-derived mesenchymal stem cells attenuates pulmonary fibrosis of silicosis via anti-inflammatory and anti-apoptosis effects in rats.Stem Cell Res Ther. 2018 Apr 19;9(1):110. doi: 10.1186/s13287-018-0846-9.
• [28] Bone marrow mesenchymal stem cells in rheumatoid arthritis, spondyloarthritis, and ankylosing spondylitis: problems rather than solutions?.Arthritis Res Ther. 2019 Nov 13;21(1):239. doi: 10.1186/s13075-019-2014-8.
• [29] Intravenous infusion of human bone marrow mesenchymal stromal cells promotes functional recovery and neuroplasticity after ischemic stroke in mice.Sci Rep. 2017 Jul 31;7(1):6962. doi: 10.1038/s41598-017-07274-w.
• [30] Intrinsic Mesenchymal Stem Cell Dysfunction in Diabetes Mellitus: Implications for Autologous Cell Therapy.Stem Cells Dev. 2017 Jul 15;26(14):1042-1053. doi: 10.1089/scd.2017.0025. Epub 2017 May 18.
• [31] Use of methylation profiling to identify significant differentially methylated genes in bone marrow mesenchymal stromal cells from acute myeloid leukemia.Int J Mol Med. 2018 Feb;41(2):679-686. doi: 10.3892/ijmm.2017.3271. Epub 2017 Nov 17.
• [32] Reciprocal Reprogramming of Cancer Cells and Associated Mesenchymal Stem Cells in Gastric Cancer.Stem Cells. 2019 Feb;37(2):176-189. doi: 10.1002/stem.2942. Epub 2018 Nov 23.
• [33] Notch1-WISP-1 axis determines the regulatory role of mesenchymal stem cell-derived stromal fibroblasts in melanoma metastasis.Oncotarget. 2016 Nov 29;7(48):79262-79273. doi: 10.18632/oncotarget.13021.
• [34] HSV-tk expressing mesenchymal stem cells exert bystander effect on human glioblastoma cells.Cancer Lett. 2010 Apr 1;290(1):58-67. doi: 10.1016/j.canlet.2009.08.028. Epub 2009 Sep 17.
• [35] Exosomes from mesenchymal stem cells modulate endoplasmic reticulum stress to protect against nucleus pulposus cell death and ameliorate intervertebral disc degeneration in vivo.Theranostics. 2019 May 31;9(14):4084-4100. doi: 10.7150/thno.33638. eCollection 2019.
• [36] Long term treatment by mesenchymal stem cells conditioned medium modulates cellular, molecular and behavioral aspects of adjuvant-induced arthritis.Cell Mol Biol (Noisy-le-grand). 2018 Jan 31;64(1):19-26. doi: 10.14715/cmb/2018.64.2.5.
• [37] Human pluripotent stem cell-derived mesenchymal stem cells prevent chronic allergic airway inflammation via TGF-1-Smad2/Smad3 signaling pathway in mice.Mol Immunol. 2019 May;109:51-57. doi: 10.1016/j.molimm.2019.02.017. Epub 2019 Mar 7.
• [38] Clonal chromosomal and genomic instability during human multipotent mesenchymal stromal cells long-term culture.PLoS One. 2018 Feb 12;13(2):e0192445. doi: 10.1371/journal.pone.0192445. eCollection 2018.
• [39] The immunomodulatory effects of adipose-derived mesenchymal stem cells and mesenchymal stem cells-conditioned medium in chronic colitis.J Cell Physiol. 2018 Nov;233(11):8754-8766. doi: 10.1002/jcp.26765. Epub 2018 May 24.
• [40] Adipose-derived Mesenchymal Stem Cells in the Treatment of Obesity: A Systematic Review of Longitudinal Studies on Preclinical Evidence.Curr Stem Cell Res Ther. 2018;13(6):466-475. doi: 10.2174/1574888X13666180515160008.
• [41] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [42] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [43] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [44] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [45] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [46] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [47] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [48] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [49] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.