Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC7WYU8)

DOT Name Homeobox protein Hox-B7 (HOXB7)
Synonyms Homeobox protein HHO.C1; Homeobox protein Hox-2C
Gene Name HOXB7
Related Disease
Acute lymphocytic leukaemia ( )
Breast neoplasm ( )
Cervical cancer ( )
Cervical carcinoma ( )
Barrett esophagus ( )
Bone osteosarcoma ( )
Breast cancer ( )
Breast carcinoma ( )
Childhood acute lymphoblastic leukemia ( )
Cholangiocarcinoma ( )
Esophageal squamous cell carcinoma ( )
Gastric cancer ( )
Glioma ( )
Hepatocellular carcinoma ( )
High blood pressure ( )
Intrahepatic cholangiocarcinoma ( )
leukaemia ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Metastatic malignant neoplasm ( )
Neoplasm ( )
Neuroblastoma ( )
Oral cancer ( )
Osteosarcoma ( )
Pancreatic adenocarcinoma ( )
Plasma cell myeloma ( )
Prostate cancer ( )
Prostate carcinoma ( )
Renal carcinoma ( )
Renal cell carcinoma ( )
Small lymphocytic lymphoma ( )
Stomach cancer ( )
Melanoma ( )
Squamous cell carcinoma ( )
Adenocarcinoma ( )
Adult glioblastoma ( )
Glioblastoma multiforme ( )
Acute myelogenous leukaemia ( )
Advanced cancer ( )
Colorectal carcinoma ( )
Fetal growth restriction ( )
Matthew-Wood syndrome ( )
Non-small-cell lung cancer ( )
UniProt ID
HXB7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046
Sequence
MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYP
GGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
ESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQ
IKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE
Function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute lymphocytic leukaemia DISPX75S Definitive Biomarker [1]
Breast neoplasm DISNGJLM Definitive Biomarker [2]
Cervical cancer DISFSHPF Definitive Biomarker [3]
Cervical carcinoma DIST4S00 Definitive Biomarker [3]
Barrett esophagus DIS416Y7 Strong Altered Expression [4]
Bone osteosarcoma DIST1004 Strong Biomarker [5]
Breast cancer DIS7DPX1 Strong Altered Expression [2]
Breast carcinoma DIS2UE88 Strong Altered Expression [2]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Biomarker [1]
Cholangiocarcinoma DIS71F6X Strong Altered Expression [6]
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [7]
Gastric cancer DISXGOUK Strong Biomarker [8]
Glioma DIS5RPEH Strong Biomarker [9]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [10]
High blood pressure DISY2OHH Strong Genetic Variation [11]
Intrahepatic cholangiocarcinoma DIS6GOC8 Strong Altered Expression [12]
leukaemia DISS7D1V Strong Altered Expression [13]
Lung adenocarcinoma DISD51WR Strong Altered Expression [14]
Lung cancer DISCM4YA Strong Altered Expression [14]
Lung carcinoma DISTR26C Strong Altered Expression [14]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [15]
Neoplasm DISZKGEW Strong Biomarker [10]
Neuroblastoma DISVZBI4 Strong Altered Expression [16]
Oral cancer DISLD42D Strong Biomarker [17]
Osteosarcoma DISLQ7E2 Strong Biomarker [5]
Pancreatic adenocarcinoma DISKHX7S Strong Biomarker [18]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [19]
Prostate cancer DISF190Y Strong Biomarker [20]
Prostate carcinoma DISMJPLE Strong Biomarker [20]
Renal carcinoma DISER9XT Strong Genetic Variation [21]
Renal cell carcinoma DISQZ2X8 Strong Genetic Variation [21]
Small lymphocytic lymphoma DIS30POX Strong Altered Expression [22]
Stomach cancer DISKIJSX Strong Biomarker [8]
Melanoma DIS1RRCY moderate Biomarker [23]
Squamous cell carcinoma DISQVIFL moderate Biomarker [24]
Adenocarcinoma DIS3IHTY Disputed Altered Expression [25]
Adult glioblastoma DISVP4LU Disputed Altered Expression [26]
Glioblastoma multiforme DISK8246 Disputed Altered Expression [26]
Acute myelogenous leukaemia DISCSPTN Limited Altered Expression [27]
Advanced cancer DISAT1Z9 Limited Altered Expression [28]
Colorectal carcinoma DIS5PYL0 Limited Biomarker [29]
Fetal growth restriction DIS5WEJ5 Limited Altered Expression [30]
Matthew-Wood syndrome DISA7HR7 Limited Biomarker [31]
Non-small-cell lung cancer DIS5Y6R9 Limited Biomarker [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 44 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
15 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Homeobox protein Hox-B7 (HOXB7). [33]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Homeobox protein Hox-B7 (HOXB7). [34]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Homeobox protein Hox-B7 (HOXB7). [35]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Homeobox protein Hox-B7 (HOXB7). [36]
Triclosan DMZUR4N Approved Triclosan increases the expression of Homeobox protein Hox-B7 (HOXB7). [37]
Testosterone enanthate DMB6871 Approved Testosterone enanthate affects the expression of Homeobox protein Hox-B7 (HOXB7). [38]
Thalidomide DM70BU5 Approved Thalidomide increases the expression of Homeobox protein Hox-B7 (HOXB7). [39]
Phenytoin DMNOKBV Approved Phenytoin increases the expression of Homeobox protein Hox-B7 (HOXB7). [39]
Nilotinib DM7HXWT Approved Nilotinib increases the expression of Homeobox protein Hox-B7 (HOXB7). [39]
Abacavir DMMN36E Approved Abacavir increases the expression of Homeobox protein Hox-B7 (HOXB7). [39]
Polyethylene glycol DM4I1JP Approved Polyethylene glycol increases the expression of Homeobox protein Hox-B7 (HOXB7). [39]
Ramelteon DM7IW9J Approved Ramelteon increases the expression of Homeobox protein Hox-B7 (HOXB7). [39]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the expression of Homeobox protein Hox-B7 (HOXB7). [39]
CHIR-99021 DMB8MNU Patented CHIR-99021 increases the expression of Homeobox protein Hox-B7 (HOXB7). [39]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Homeobox protein Hox-B7 (HOXB7). [41]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Homeobox protein Hox-B7 (HOXB7). [40]
------------------------------------------------------------------------------------

References

1 Inhibition of HOXB7 suppresses p27-mediated acute lymphoblastic leukemia by regulating basic fibroblast growth factor and ERK1/2.Life Sci. 2019 Feb 1;218:1-7. doi: 10.1016/j.lfs.2018.12.011. Epub 2018 Dec 8.
2 HOXB7 promotes malignant progression by activating the TGF signaling pathway.Cancer Res. 2015 Feb 15;75(4):709-19. doi: 10.1158/0008-5472.CAN-14-3100. Epub 2014 Dec 26.
3 MicroRNA-196b regulates the homeobox B7-vascular endothelial growth factor axis in cervical cancer.PLoS One. 2013 Jul 4;8(7):e67846. doi: 10.1371/journal.pone.0067846. Print 2013.
4 Evidence for a functional role of epigenetically regulated midcluster HOXB genes in the development of Barrett esophagus.Proc Natl Acad Sci U S A. 2012 Jun 5;109(23):9077-82. doi: 10.1073/pnas.1116933109. Epub 2012 May 17.
5 Downregulation of Homeobox B7 Inhibits the Tumorigenesis and Progression of Osteosarcoma.Oncol Res. 2017 Aug 7;25(7):1089-1095. doi: 10.3727/096504016X14784668796788. Epub 2016 Nov 8.
6 Detection of IGF2BP3, HOXB7, and NEK2 mRNA expression in brush cytology specimens as a new diagnostic tool in patients with biliary strictures.PLoS One. 2012;7(8):e42141. doi: 10.1371/journal.pone.0042141. Epub 2012 Aug 7.
7 Targeting HOX/PBX dimer formation as a potential therapeutic option in esophageal squamous cell carcinoma.Cancer Sci. 2019 May;110(5):1735-1745. doi: 10.1111/cas.13993. Epub 2019 Apr 5.
8 Homeobox B7 accelerates the cancer progression of gastric carcinoma cells by promoting epithelial-mesenchymal transition (EMT) and activating Src-FAK pathway.Onco Targets Ther. 2019 May 16;12:3743-3751. doi: 10.2147/OTT.S198115. eCollection 2019.
9 HOXB7 promotes proliferation and metastasis of glioma by regulating the Wnt/-catenin pathway.Eur Rev Med Pharmacol Sci. 2019 Mar;23(6):2476-2485. doi: 10.26355/eurrev_201903_17395.
10 The let-7c/HoxB7 axis regulates the cell proliferation, migration and apoptosis in hepatocellular carcinoma.Anticancer Drugs. 2020 Jan;31(1):6-18. doi: 10.1097/CAD.0000000000000843.
11 Trans-ancestry meta-analyses identify rare and common variants associated with blood pressure and hypertension.Nat Genet. 2016 Oct;48(10):1151-1161. doi: 10.1038/ng.3654. Epub 2016 Sep 12.
12 Upregulated expression of HOXB7 in intrahepatic cholangiocarcinoma is associated with tumor cell metastasis and poor prognosis.Lab Invest. 2019 Jun;99(6):736-748. doi: 10.1038/s41374-018-0150-4. Epub 2019 Jan 21.
13 Expression of selected human HOX-2 genes in B/T acute lymphoid leukemia and interleukin-2/interleukin-1 beta-stimulated natural killer lymphocytes.Blood. 1992 Jul 1;80(1):185-93.
14 HOXB7 overexpression in lung cancer is a hallmark of acquired stem-like phenotype.Oncogene. 2018 Jun;37(26):3575-3588. doi: 10.1038/s41388-018-0229-9. Epub 2018 Mar 26.
15 miR-196b-5p Regulates Colorectal Cancer Cell Migration and Metastases through Interaction with HOXB7 and GALNT5.Clin Cancer Res. 2017 Sep 1;23(17):5255-5266. doi: 10.1158/1078-0432.CCR-17-0023. Epub 2017 May 22.
16 Modulation of HOX2 gene expression following differentiation of neuronal cell lines.Differentiation. 1992 Sep;51(1):39-47. doi: 10.1111/j.1432-0436.1992.tb00678.x.
17 Overexpression of HOXB7 protein reduces sensitivity of oral cancer cells to chemo-radiotherapy.Cancer Gene Ther. 2016 Dec;23(12):419-424. doi: 10.1038/cgt.2016.55. Epub 2016 Nov 11.
18 HOXB7 promotes invasion and predicts survival in pancreatic adenocarcinoma.Cancer. 2013 Feb 1;119(3):529-39. doi: 10.1002/cncr.27725. Epub 2012 Aug 22.
19 Overexpression of HOXB7 and homeobox genes characterizes multiple myeloma patients lacking the major primary immunoglobulin heavy chain locus translocations.Am J Hematol. 2011 Dec;86(12):E64-6. doi: 10.1002/ajh.22164. Epub 2011 Sep 22.
20 The relationship between homeobox B7 expression and the clinical characteristics of patient with prostate cancer.J Cell Biochem. 2019 Apr;120(4):6395-6401. doi: 10.1002/jcb.27926. Epub 2018 Oct 14.
21 HOX gene expression in normal and neoplastic human kidney.Int J Cancer. 1992 Jul 30;51(6):892-7. doi: 10.1002/ijc.2910510610.
22 Downregulation of death-associated protein kinase 1 (DAPK1) in chronic lymphocytic leukemia.Cell. 2007 Jun 1;129(5):879-90. doi: 10.1016/j.cell.2007.03.043.
23 Oncogenic HoxB7 requires TALE cofactors and is inactivated by a dominant-negative Pbx1 mutant in a cell-specific manner.Cancer Lett. 2008 Aug 8;266(2):144-55. doi: 10.1016/j.canlet.2008.02.042. Epub 2008 Apr 2.
24 Prognostic value of HOXB7 mRNA expression in human oesophageal squamous cell cancer.Biomarkers. 2013 Jun;18(4):297-303. doi: 10.3109/1354750X.2013.773380. Epub 2013 Apr 29.
25 HOXB7 mRNA is overexpressed in pancreatic ductal adenocarcinomas and its knockdown induces cell cycle arrest and apoptosis.BMC Cancer. 2013 Oct 2;13:451. doi: 10.1186/1471-2407-13-451.
26 Inhibition of 13-cis retinoic acid-induced gene expression of homeobox B7 by thalidomide.Int J Cancer. 2007 Sep 15;121(6):1205-11. doi: 10.1002/ijc.22815.
27 Characteristic patterns of HOX gene expression in different types of human leukemia.Int J Cancer. 1993 Jan 21;53(2):237-44. doi: 10.1002/ijc.2910530211.
28 Deregulated HOXB7 expression predicts poor prognosis of patients with malignancies of digestive system.Minerva Chir. 2019 Oct;74(5):422-430. doi: 10.23736/S0026-4733.17.07325-4. Epub 2017 Jul 26.
29 circIFT80 Functions as a ceRNA of miR-1236-3p to Promote Colorectal Cancer Progression.Mol Ther Nucleic Acids. 2019 Dec 6;18:375-387. doi: 10.1016/j.omtn.2019.08.024. Epub 2019 Sep 3.
30 Down-regulation of DKK1 and Wnt1/-catenin pathway by increased homeobox B7 resulted in cell differentiation suppression of intrauterine fetal growth retardation in human placenta.Placenta. 2019 May;80:27-35. doi: 10.1016/j.placenta.2019.03.001. Epub 2019 Mar 11.
31 miR-337 regulates the proliferation and invasion in pancreatic ductal adenocarcinoma by targeting HOXB7.Diagn Pathol. 2014 Sep 3;9:171. doi: 10.1186/s13000-014-0171-2.
32 Effects of siRNA Silencing of TUG1 and LCAL6 Long Non-coding RNAs on Patient-derived Xenograft of Non-small Cell Lung Cancer.Anticancer Res. 2018 Jan;38(1):179-186. doi: 10.21873/anticanres.12206.
33 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
34 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
35 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
36 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
37 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
38 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
39 Exposure-based assessment of chemical teratogenicity using morphogenetic aggregates of human embryonic stem cells. Reprod Toxicol. 2020 Jan;91:74-91. doi: 10.1016/j.reprotox.2019.10.004. Epub 2019 Nov 8.
40 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
41 Gene expression profiling reveals novel regulation by bisphenol-A in estrogen receptor-alpha-positive human cells. Environ Res. 2006 Jan;100(1):86-92.