Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG4WT05)

DOT Name	Glutathione S-transferase Mu 2 (GSTM2)
Synonyms	EC 2.5.1.18; GST class-mu 2; GSTM2-2
Gene Name	GSTM2
Related Disease	Esophageal squamous cell carcinoma ( ) Ovarian cancer ( ) Ovarian neoplasm ( ) Acute kidney injury ( ) Acute lymphocytic leukaemia ( ) Advanced cancer ( ) Asthma ( ) Bladder cancer ( ) Carcinoma of esophagus ( ) Chromosomal disorder ( ) Chronic obstructive pulmonary disease ( ) Clear cell renal carcinoma ( ) Colorectal carcinoma ( ) Endometriosis ( ) Epithelial ovarian cancer ( ) Head and neck cancer ( ) Head and neck carcinoma ( ) Head-neck squamous cell carcinoma ( ) Hepatitis B virus infection ( ) Inflammatory bowel disease ( ) Myocardial ischemia ( ) Non-small-cell lung cancer ( ) Oral cancer ( ) Parkinson disease ( ) Prostate cancer ( ) Prostate carcinoma ( ) Psoriasis ( ) Renal cell carcinoma ( ) Rheumatoid arthritis ( ) Schizophrenia ( ) Urinary bladder cancer ( ) Urinary bladder neoplasm ( ) Gastric cancer ( ) High blood pressure ( ) Stomach cancer ( ) Coronary atherosclerosis ( ) Coronary heart disease ( ) Lung cancer ( ) Lung carcinoma ( ) Melanoma ( ) Myocardial infarction ( ) Nasopharyngeal carcinoma ( ) OPTN-related open angle glaucoma ( )
UniProt ID	GSTM2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1HNA; 1HNB; 1HNC; 1XW5; 1YKC; 2AB6; 2C4J; 2GTU; 3GTU; 3GUR; 5HWL
EC Number	2.5.1.18
Pfam ID	PF00043 ; PF02798
Sequence	MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL PYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF EKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
Function	Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Participates in the formation of novel hepoxilin regioisomers.
Tissue Specificity	Muscle.
KEGG Pathway	Glutathione metabolism (hsa00480 ) Metabolism of xenobiotics by cytochrome P450 (hsa00980 ) Drug metabolism - cytochrome P450 (hsa00982 ) Drug metabolism - other enzymes (hsa00983 ) Metabolic pathways (hsa01100 ) Platinum drug resistance (hsa01524 ) Pathways in cancer (hsa05200 ) Chemical carcinogenesis - D. adducts (hsa05204 ) Chemical carcinogenesis - receptor activation (hsa05207 ) Chemical carcinogenesis - reactive oxygen species (hsa05208 ) Hepatocellular carcinoma (hsa05225 ) Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway	Glutathione conjugation (R-HSA-156590 )

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Esophageal squamous cell carcinoma	DIS5N2GV	Definitive	Genetic Variation	[1]
Ovarian cancer	DISZJHAP	Definitive	Genetic Variation	[2]
Ovarian neoplasm	DISEAFTY	Definitive	Genetic Variation	[2]
Acute kidney injury	DISXZG0T	Strong	Biomarker	[3]
Acute lymphocytic leukaemia	DISPX75S	Strong	Genetic Variation	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Asthma	DISW9QNS	Strong	Biomarker	[6]
Bladder cancer	DISUHNM0	Strong	Genetic Variation	[7]
Carcinoma of esophagus	DISS6G4D	Strong	Genetic Variation	[8]
Chromosomal disorder	DISM5BB5	Strong	Biomarker	[9]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Genetic Variation	[10]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[12]
Endometriosis	DISX1AG8	Strong	Genetic Variation	[13]
Epithelial ovarian cancer	DIS56MH2	Strong	Genetic Variation	[2]
Head and neck cancer	DISBPSQZ	Strong	Genetic Variation	[14]
Head and neck carcinoma	DISOU1DS	Strong	Genetic Variation	[14]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Genetic Variation	[15]
Hepatitis B virus infection	DISLQ2XY	Strong	Genetic Variation	[16]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[17]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[18]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Genetic Variation	[19]
Oral cancer	DISLD42D	Strong	Genetic Variation	[20]
Parkinson disease	DISQVHKL	Strong	Genetic Variation	[21]
Prostate cancer	DISF190Y	Strong	Posttranslational Modification	[22]
Prostate carcinoma	DISMJPLE	Strong	Posttranslational Modification	[22]
Psoriasis	DIS59VMN	Strong	Genetic Variation	[23]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[11]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[24]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[25]
Urinary bladder cancer	DISDV4T7	Strong	Genetic Variation	[7]
Urinary bladder neoplasm	DIS7HACE	Strong	Genetic Variation	[7]
Gastric cancer	DISXGOUK	moderate	Genetic Variation	[26]
High blood pressure	DISY2OHH	moderate	Genetic Variation	[27]
Stomach cancer	DISKIJSX	moderate	Genetic Variation	[26]
Coronary atherosclerosis	DISKNDYU	Limited	Genetic Variation	[28]
Coronary heart disease	DIS5OIP1	Limited	Genetic Variation	[28]
Lung cancer	DISCM4YA	Limited	Genetic Variation	[29]
Lung carcinoma	DISTR26C	Limited	Genetic Variation	[29]
Melanoma	DIS1RRCY	Limited	Genetic Variation	[30]
Myocardial infarction	DIS655KI	Limited	Genetic Variation	[31]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Genetic Variation	[32]
OPTN-related open angle glaucoma	DISDR98A	Limited	Genetic Variation	[33]
------------------------------------------------------------------------------------


⏷ Show the Full List of 43 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Glutathione S-transferase Mu 2 (GSTM2) affects the response to substance of Cisplatin.	[55]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	Glutathione S-transferase Mu 2 (GSTM2) decreases the response to substance of 4-hydroxy-2-nonenal.	[60]
------------------------------------------------------------------------------------

This DOT Affected the Biotransformations of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
DTI-015	DMXZRW0	Approved	Glutathione S-transferase Mu 2 (GSTM2) decreases the nitrosation of DTI-015.	[56]
Dinoprostone	DMTYOPD	Approved	Glutathione S-transferase Mu 2 (GSTM2) affects the chemical synthesis of Dinoprostone.	[57]
------------------------------------------------------------------------------------

This DOT Affected the Regulation of Drug Effects of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Glutathione	DMAHMT9	Approved	Glutathione S-transferase Mu 2 (GSTM2) affects the metabolism of Glutathione.	[54]
DNCB	DMDTVYC	Phase 2	Glutathione S-transferase Mu 2 (GSTM2) affects the metabolism of DNCB.	[59]
PGH2	DMZFVGC	Investigative	Glutathione S-transferase Mu 2 (GSTM2) affects the metabolism of PGH2.	[57]
------------------------------------------------------------------------------------

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[34]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[35]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[36]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[38]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[39]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[39]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[40]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[41]
Diclofenac	DMPIHLS	Approved	Diclofenac decreases the activity of Glutathione S-transferase Mu 2 (GSTM2).	[42]
Beta-carotene	DM0RXBT	Approved	Beta-carotene increases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[43]
Eicosapentaenoic acid/docosa-hexaenoic acid	DMMUCG4	Approved	Eicosapentaenoic acid/docosa-hexaenoic acid increases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[44]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[46]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 decreases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[48]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Glutathione S-transferase Mu 2 (GSTM2).	[49]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[50]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A affects the expression of Glutathione S-transferase Mu 2 (GSTM2).	[51]
Paraoxon	DMN4ZKC	Investigative	Paraoxon increases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[52]
Icosapentum	DMF1CM7	Investigative	Icosapentum increases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[44]
GW-788388	DMIBUW5	Investigative	GW-788388 increases the expression of Glutathione S-transferase Mu 2 (GSTM2).	[53]
S-hexylglutathione	DMNWP02	Investigative	S-hexylglutathione decreases the activity of Glutathione S-transferase Mu 2 (GSTM2).	[54]
------------------------------------------------------------------------------------


⏷ Show the Full List of 21 Drug(s)

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Glutathione S-transferase Mu 2 (GSTM2).	[37]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Glutathione S-transferase Mu 2 (GSTM2).	[45]
------------------------------------------------------------------------------------

References

1	Interactions between Glutathione-S-Transferase M1, T1 and P1 polymorphisms and smoking, and increased susceptibility to esophageal squamous cell carcinoma.Cancer Epidemiol. 2010 Jun;34(3):285-90. doi: 10.1016/j.canep.2010.03.009. Epub 2010 Apr 20.
2	Association between glutathione S-transferase M 1 null genotype and risk of ovarian cancer: a meta-analysis.Tumour Biol. 2013 Dec;34(6):4059-63. doi: 10.1007/s13277-013-0995-5. Epub 2013 Jul 25.
3	Phenotypic and genotypic assessment of concomitant drug-induced toxic effects in liver, kidney and blood.J Appl Toxicol. 2011 Mar;31(2):117-30. doi: 10.1002/jat.1562.
4	Novel insights into etiologies of leukemia: a HuGE review and meta-analysis of CYP1A1 polymorphisms and leukemia risk.Am J Epidemiol. 2013 Aug 15;178(4):493-507. doi: 10.1093/aje/kwt016. Epub 2013 May 24.
5	Tracing biomarker of PAH-exposure and susceptibility factor (GSTM-polymorphism) among cancer patients in Pakistan.Chemosphere. 2017 Jul;178:384-390. doi: 10.1016/j.chemosphere.2017.03.017. Epub 2017 Mar 7.
6	Expression pattern of GSTP1 and GSTA1 in the pathogenesis of asthma.Exp Lung Res. 2013 May-Jun;39(4-5):173-81. doi: 10.3109/01902148.2013.789572. Epub 2013 May 7.
7	A six-gene prognostic model predicts overall survival in bladder cancer patients.Cancer Cell Int. 2019 Sep 5;19:229. doi: 10.1186/s12935-019-0950-7. eCollection 2019.
8	Glutathione S-transferase M1 polymorphism and esophageal cancer risk: An updated meta-analysis based on 37 studies.World J Gastroenterol. 2016 Feb 7;22(5):1911-8. doi: 10.3748/wjg.v22.i5.1911.
9	Impact of sodium arsenite on chromosomal aberrations with respect to polymorphisms of detoxification and DNA repair genes.Int J Toxicol. 2014 Nov-Dec;33(6):518-22. doi: 10.1177/1091581814557953. Epub 2014 Nov 12.
10	Glutathione S-transferase M1 and T1 gene polymorphism and COPD risk in smokers: an updated analysis.Mol Biol Rep. 2012 Apr;39(4):5033-42. doi: 10.1007/s11033-011-1300-6. Epub 2011 Dec 9.
11	Association of glutathione S-transferase M1, T1, and P1 polymorphisms with renal cell carcinoma: evidence from 11 studies.Tumour Biol. 2014 Apr;35(4):3867-73. doi: 10.1007/s13277-013-1513-5. Epub 2013 Dec 15.
12	Association of glutathione S-transferase M1 polymorphisms in the colorectal cancer risk: A meta-analysis.J Cancer Res Ther. 2018 Jan;14(1):176-183. doi: 10.4103/jcrt.JCRT_446_16.
13	Glutathione S-transferase M1 and T1 gene polymorphisms and risk of endometriosis in Tunisian population.Hum Fertil (Camb). 2015 Jun;18(2):128-33. doi: 10.3109/14647273.2014.989925. Epub 2014 Dec 30.
14	Meta-analysis of glutathione S-transferase M1 genotype and risk toward head and neck cancer.Head Neck. 2006 Mar;28(3):217-24. doi: 10.1002/hed.20295.
15	Cytochrome P450 2E1 and head and neck cancer: interaction with genetic and environmental risk factors.Environ Mol Mutagen. 2009 Jul;50(6):473-82. doi: 10.1002/em.20488.
16	N-Acetyltransferase-2, glutathione S-transferase M1 and T1 genetic polymorphisms, cigarette smoking and hepatocellular carcinoma: a case-control study.Int J Cancer. 2005 Jun 10;115(2):301-6. doi: 10.1002/ijc.20895.
17	Azathioprine Biotransformation in Young Patients with Inflammatory Bowel Disease: Contribution of Glutathione-S Transferase M1 and A1 Variants.Genes (Basel). 2019 Apr 4;10(4):277. doi: 10.3390/genes10040277.
18	Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
19	Genetic polymorphisms of glutathione S-transferase M1 and T1, and evaluation of oxidative stress in patients with non-small cell lung cancer.Eur J Med Res. 2014 Dec 4;19(1):67. doi: 10.1186/s40001-014-0067-3.
20	Glutathione S-transferase M1 null genotype is associated with increased risk of oral cancer in East Asians: a meta-analysis.Tumour Biol. 2013 Oct;34(5):3183-8. doi: 10.1007/s13277-013-0888-7. Epub 2013 Jun 26.
21	Glutathione S-transferase M1 polymorphisms and Parkinson's disease risk: a meta-analysis.Neurol Res. 2016 Feb;38(2):144-50. doi: 10.1080/01616412.2015.1126996. Epub 2016 Mar 16.
22	A DNA Hypermethylation Profile Independently Predicts Biochemical Recurrence Following Radical Prostatectomy.Urol Int. 2016;97(1):16-25. doi: 10.1159/000446446. Epub 2016 May 25.
23	Association between genetic polymorphisms of glutathione S-transferase M1/T1 and psoriasis in a population from the area of the strict of messina (Southern Italy).Free Radic Res. 2020 Jan;54(1):57-63. doi: 10.1080/10715762.2019.1698738. Epub 2019 Dec 10.
24	Measurement of absolute copy number variation of Glutathione S-Transferase M1 gene by digital droplet PCR and association analysis in Tunisian Rheumatoid Arthritis population.J Clin Lab Anal. 2018 Mar;32(3):e22300. doi: 10.1002/jcla.22300. Epub 2017 Jul 13.
25	Genetic Polymorphisms of Glutathione-Related Enzymes (GSTM1, GSTT1, and GSTP1) and Schizophrenia Risk: A Meta-Analysis.Int J Mol Sci. 2015 Aug 19;16(8):19602-11. doi: 10.3390/ijms160819602.
26	Glutathione S-transferase M1 null genotype meta-analysis on gastric cancer risk.Diagn Pathol. 2014 Jun 19;9:122. doi: 10.1186/1746-1596-9-122.
27	Glutathione S-Transferase M1 and T1 polymorphisms and hypertension risk: an updated meta-analysis.J Hum Hypertens. 2019 Jun;33(6):454-465. doi: 10.1038/s41371-018-0133-3. Epub 2018 Nov 12.
28	Glutathione S-transferase M1 polymorphism and coronary heart disease susceptibility: a meta-analysis involving 47,596 subjects.Heart Lung Circ. 2014 Jun;23(6):578-85. doi: 10.1016/j.hlc.2014.01.003. Epub 2014 Jan 22.
29	Combined effects of glutathione S-transferase M1 and T1 polymorphisms on risk of lung cancer: Evidence from a meta-analysis.Oncotarget. 2017 Apr 25;8(17):28135-28143. doi: 10.18632/oncotarget.15943.
30	Glutathione S-transferase M1/T1 genotype and melanoma in a Southern Italian population: a case-control study.G Ital Dermatol Venereol. 2016 Apr;151(2):140-4. Epub 2015 Jan 14.
31	Glutathione S-transferase M1 and T1 genotypes and myocardial infarction.Mol Biol Rep. 2013 Apr;40(4):3263-7. doi: 10.1007/s11033-012-2401-6. Epub 2012 Dec 30.
32	Real-time PCR assay for rapid detection of GSTM1 polymorphism in nasopharyngeal carcinoma patients.Asian Pac J Cancer Prev. 2008 Apr-Jun;9(2):233-7.
33	Glutathione S transferase M1 and T1 genetic polymorphisms are related to the risk of primary open-angle glaucoma: a study in a Turkish population.Br J Ophthalmol. 2007 Apr;91(4):527-30. doi: 10.1136/bjo.2006.102418. Epub 2006 Sep 14.
34	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
35	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
36	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
37	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
38	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
39	Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
40	Expression of glutathione S-transferase M2 in stage I/II non-small cell lung cancer and alleviation of DNA damage exposure to benzo[a]pyrene. Toxicol Lett. 2010 Feb 15;192(3):316-23. doi: 10.1016/j.toxlet.2009.11.003. Epub 2009 Nov 10.
41	Xenobiotic CAR activators induce Dlk1-Dio3 locus noncoding RNA expression in mouse liver. Toxicol Sci. 2017 Aug 1;158(2):367-378.
42	Simulation of interindividual differences in inactivation of reactive para-benzoquinone imine metabolites of diclofenac by glutathione S-transferases in human liver cytosol. Toxicol Lett. 2016 Jul 25;255:52-62.
43	Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
44	Astaxanthin and omega-3 fatty acids individually and in combination protect against oxidative stress via the Nrf2-ARE pathway. Food Chem Toxicol. 2013 Dec;62:869-75.
45	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
46	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
47	Global expression profiling of theophylline response genes in macrophages: evidence of airway anti-inflammatory regulation. Respir Res. 2005 Aug 8;6(1):89. doi: 10.1186/1465-9921-6-89.
48	Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
49	DNA hypermethylation regulates the expression of members of the Mu-class glutathione S-transferases and glutathione peroxidases in Barrett's adenocarcinoma. Gut. 2009 Jan;58(1):5-15. doi: 10.1136/gut.2007.146290. Epub 2008 Jul 29.
50	Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
51	Microphysiological system modeling of ochratoxin A-associated nephrotoxicity. Toxicology. 2020 Nov;444:152582. doi: 10.1016/j.tox.2020.152582. Epub 2020 Sep 6.
52	Oxidative stress resulting from exposure of a human salivary gland cells to paraoxon: an in vitro model for organophosphate oral exposure. Toxicol In Vitro. 2014 Aug;28(5):715-21. doi: 10.1016/j.tiv.2014.01.009. Epub 2014 Jan 29.
53	Capturing time-dependent activation of genes and stress-response pathways using transcriptomics in iPSC-derived renal proximal tubule cells. Cell Biol Toxicol. 2023 Aug;39(4):1773-1793. doi: 10.1007/s10565-022-09783-5. Epub 2022 Dec 31.
54	Ligand-induced changes in the structure and dynamics of a human class Mu glutathione S-transferase. Biochemistry. 2000 Jun 27;39(25):7343-56. doi: 10.1021/bi992767d.
55	Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
56	The polymorphic human glutathione transferase T1-1, the most efficient glutathione transferase in the denitrosation and inactivation of the anticancer drug 1,3-bis(2-chloroethyl)-1-nitrosourea. Biochem Pharmacol. 2002 Jan 15;63(2):191-7. doi: 10.1016/s0006-2952(01)00846-2.
57	Identification of mu-class glutathione transferases M2-2 and M3-3 as cytosolic prostaglandin E synthases in the human brain. Neurochem Res. 2000 May;25(5):733-8. doi: 10.1023/a:1007579507804.
58	Ligand-induced changes in the structure and dynamics of a human class Mu glutathione S-transferase. Biochemistry. 2000 Jun 27;39(25):7343-56. doi: 10.1021/bi992767d.
59	Liver glutathione S-transferase polymorphism in Japanese and its pharmacogenetic importance. Hum Genet. 1987 Apr;75(4):322-5. doi: 10.1007/BF00284101.
60	Genotoxicity of 4-hydroxy-2-nonenal in human colon tumor cells is associated with cellular levels of glutathione and the modulation of glutathione S-transferase A4 expression by butyrate. Toxicol Sci. 2005 Jul;86(1):27-35. doi: 10.1093/toxsci/kfi171. Epub 2005 Apr 13.