Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIB1P8A)

• DOT Name: Small G protein signaling modulator 3 (SGSM3)
• Synonyms: Merlin-associated protein; RUN and TBC1 domain-containing protein 3; Rab-GTPase-activating protein-like protein; RabGAPLP
• Gene Name: SGSM3
• Related Disease:
  Adenocarcinoma
  Epilepsy
  Adult glioblastoma
  Advanced cancer
  Autoimmune disease
  Bladder cancer
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Colon cancer
  Colon carcinoma
  Glioblastoma multiforme
  Hepatocellular carcinoma
  High blood pressure
  Inflammatory bowel disease
  Lung carcinoma
  Melanoma
  Multiple sclerosis
  Neoplasm
  Neuroblastoma
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Obesity
  Osteosarcoma
  Parkinson disease
  Plasma cell myeloma
  Prostate carcinoma
  Rheumatoid arthritis
  Stroke
  Systemic lupus erythematosus
  Tauopathy
  Thyroid cancer
  Thyroid tumor
  Ulcerative colitis
  Acute myelogenous leukaemia
  Cardiofaciocutaneous syndrome
  Crohn disease
  Thyroid gland papillary carcinoma
  Triple negative breast cancer
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Carcinoma
  Head-neck squamous cell carcinoma
  Lung cancer
  Pancreatic cancer
  Prostate cancer
  Thyroid gland carcinoma
  Type-1/2 diabetes
• UniProt ID: SGSM3_HUMAN
• Pfam ID: PF00566 ; PF02759 ; PF00018
• Sequence:
  MSGSHTPACGPFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSS
  LLANSPLMEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHGMR
  PQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFASMGSIG
  VPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMSAIIEDLLPASYFSTT
  LLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIKLLLRIWDL
  FFYEGSRVLFQLTLGMLHLKEEELIQSENSASIFNTLSDIPSQMEDAELLLGVAMRLAGS
  LTDVAVETQRRKHLAYLIADQGQLLGAGTLTNLSQVVRRRTQRRKSTITALLFGEDDLEA
  LKAKNIKQTELVADLREAILRVARHFQCTDPKNCSVELTPDYSMESHQRDHENYVACSRS
  HRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDER
  SKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREV
  ERDFASVYSRLVLCKTFRLDEDGKVLTPEELLYRAVQSVNVTHDAVHAQMDVKLRSLICV
  GLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELP
  AKREAQQPLKEGVRDMLVKHHLFSWDVDG
• Function: May play a cooperative role in NF2-mediated growth suppression of cells.
• Tissue Specificity: Widely expressed.

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Definitive	Biomarker	[1]
Epilepsy	DISBB28L	Definitive	Biomarker	[2]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Autoimmune disease	DISORMTM	Strong	Biomarker	[5]
Bladder cancer	DISUHNM0	Strong	Genetic Variation	[6]
Bone osteosarcoma	DIST1004	Strong	Genetic Variation	[7]
Breast cancer	DIS7DPX1	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[9]
Colon cancer	DISVC52G	Strong	Biomarker	[10]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[10]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[3]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[11]
High blood pressure	DISY2OHH	Strong	Biomarker	[12]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[13]
Lung carcinoma	DISTR26C	Strong	Biomarker	[14]
Melanoma	DIS1RRCY	Strong	Biomarker	[15]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[16]
Neoplasm	DISZKGEW	Strong	Biomarker	[17]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[18]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[19]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Genetic Variation	[20]
Obesity	DIS47Y1K	Strong	Biomarker	[21]
Osteosarcoma	DISLQ7E2	Strong	Genetic Variation	[7]
Parkinson disease	DISQVHKL	Strong	Biomarker	[22]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[23]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[24]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[25]
Stroke	DISX6UHX	Strong	Biomarker	[26]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[27]
Tauopathy	DISY2IPA	Strong	Biomarker	[28]
Thyroid cancer	DIS3VLDH	Strong	Biomarker	[29]
Thyroid tumor	DISLVKMD	Strong	Biomarker	[29]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[30]
Acute myelogenous leukaemia	DISCSPTN	moderate	Altered Expression	[31]
Cardiofaciocutaneous syndrome	DISZJKSC	moderate	Genetic Variation	[32]
Crohn disease	DIS2C5Q8	moderate	Biomarker	[13]
Thyroid gland papillary carcinoma	DIS48YMM	moderate	Genetic Variation	[33]
Triple negative breast cancer	DISAMG6N	moderate	Biomarker	[34]
Alzheimer disease	DISF8S70	Limited	Biomarker	[2]
Arteriosclerosis	DISK5QGC	Limited	Biomarker	[35]
Atherosclerosis	DISMN9J3	Limited	Biomarker	[35]
Carcinoma	DISH9F1N	Limited	Biomarker	[36]
Head-neck squamous cell carcinoma	DISF7P24	Limited	Genetic Variation	[37]
Lung cancer	DISCM4YA	Limited	Genetic Variation	[38]
Pancreatic cancer	DISJC981	Limited	Biomarker	[39]
Prostate cancer	DISF190Y	Limited	Biomarker	[24]
Thyroid gland carcinoma	DISMNGZ0	Limited	Altered Expression	[40]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[41]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Small G protein signaling modulator 3 (SGSM3).	[42]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Small G protein signaling modulator 3 (SGSM3).	[43]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the expression of Small G protein signaling modulator 3 (SGSM3).	[44]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Small G protein signaling modulator 3 (SGSM3).	[46]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Small G protein signaling modulator 3 (SGSM3).	[45]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Small G protein signaling modulator 3 (SGSM3).	[47]

References

• [1] Mutations in the RAS/RAF/MAP kinase pathway commonly occur in gallbladder adenomas but are uncommon in gallbladder adenocarcinomas.Appl Immunohistochem Mol Morphol. 2011 Mar;19(2):133-40. doi: 10.1097/PAI.0b013e3181f09179.
• [2] Tau Related Pathways as a Connecting Link between Epilepsy and Alzheimer's Disease.ACS Chem Neurosci. 2019 Oct 16;10(10):4199-4212. doi: 10.1021/acschemneuro.9b00460. Epub 2019 Sep 30.
• [3] Expression Profiling of the MAP Kinase Phosphatase Family Reveals a Role for DUSP1 in the Glioblastoma Stem Cell Niche.Cancer Microenviron. 2017 Dec;10(1-3):57-68. doi: 10.1007/s12307-017-0197-6. Epub 2017 Aug 18.
• [4] Targeting ERK1/2 protein-serine/threonine kinases in human cancers.Pharmacol Res. 2019 Apr;142:151-168. doi: 10.1016/j.phrs.2019.01.039. Epub 2019 Feb 20.
• [5] Glomerulonephritis and granulomatous vasculitis in kidney as a complication of the use of BRAF and MEK inhibitors in the treatment of metastatic melanoma: A case report.Medicine (Baltimore). 2017 Jun;96(25):e7196. doi: 10.1097/MD.0000000000007196.
• [6] Evaluation of 4-bp insertion/deletion polymorphism within the 3'UTR of SGSM3 in bladder cancer using mismatch PCR-RFLP method: A preliminary report.J Cell Biochem. 2018 Aug;119(8):6566-6574. doi: 10.1002/jcb.26764. Epub 2018 Apr 25.
• [7] Histologic Response and Toxicity following Interval-Compressed Four-Drug Therapy Given Preoperatively in Children and Young Adults with Osteosarcoma: A Retrospective Study.Oncology. 2020;98(2):81-90. doi: 10.1159/000502548. Epub 2019 Sep 11.
• [8] Synthesis and molecular docking studies of new furochromone derivatives as p38 MAPK inhibitors targeting human breast cancer MCF-7 cells.Bioorg Med Chem. 2017 Apr 15;25(8):2423-2436. doi: 10.1016/j.bmc.2017.02.065. Epub 2017 Mar 3.
• [9] Genetic variants of ESR1 and SGSM3 are associated with the susceptibility of breast cancer in the Chinese population.Breast Cancer. 2017 May;24(3):369-374. doi: 10.1007/s12282-016-0712-5. Epub 2016 Jul 18.
• [10] The 6-integrin-ERK/MAP kinase pathway contributes to chemo resistance in colon cancer.Cancer Lett. 2013 Jan 28;328(2):325-34. doi: 10.1016/j.canlet.2012.10.004. Epub 2012 Oct 13.
• [11] The microtubule-associated protein PRC1 promotes early recurrence of hepatocellular carcinoma in association with the Wnt/-catenin signalling pathway.Gut. 2016 Sep;65(9):1522-34. doi: 10.1136/gutjnl-2015-310625. Epub 2016 Mar 3.
• [12] Blood Pressure and End-tidal Carbon Dioxide Ranges during Aneurysm Occlusion and Neurologic Outcome after an Aneurysmal Subarachnoid Hemorrhage.Anesthesiology. 2019 Jan;130(1):92-105. doi: 10.1097/ALN.0000000000002482.
• [13] Prevalence of Mycobacterium avium subspecies paratuberculosis IS 900 DNA in biopsy tissues from patients with Crohn's disease: histopathological and molecular comparison with Johne's disease in Fars province of Iran.BMC Infect Dis. 2019 Jan 7;19(1):23. doi: 10.1186/s12879-018-3619-2.
• [14] PLOD3 promotes lung metastasis via regulation of STAT3.Cell Death Dis. 2018 Nov 15;9(12):1138. doi: 10.1038/s41419-018-1186-5.
• [15] Mitogen-activated protein kinase dependency in BRAF/RAS wild-type melanoma: A rationale for combination inhibitors.Pigment Cell Melanoma Res. 2020 Mar;33(2):345-357. doi: 10.1111/pcmr.12824. Epub 2019 Sep 25.
• [16] Sex-specific Tau methylation patterns and synaptic transcriptional alterations are associated with neural vulnerability during chronic neuroinflammation.J Autoimmun. 2019 Jul;101:56-69. doi: 10.1016/j.jaut.2019.04.003. Epub 2019 Apr 19.
• [17] Screening and characterization of a novel high-efficiency tumor-homing cell-penetrating peptide from the buffalo cathelicidin family.J Pept Sci. 2019 Sep;25(9):e3201. doi: 10.1002/psc.3201. Epub 2019 Jul 15.
• [18] DUSP5 expression associates with poor prognosis in human neuroblastoma.Exp Mol Pathol. 2018 Dec;105(3):272-278. doi: 10.1016/j.yexmp.2018.08.008. Epub 2018 Aug 30.
• [19] Methylation changes in the peripheral blood of Filipinos with type 2 diabetes suggest spurious transcription initiation at TXNIP.Hum Mol Genet. 2019 Dec 15;28(24):4208-4218. doi: 10.1093/hmg/ddz262.
• [20] Palbociclib resistance confers dependence on an FGFR-MAP kinase-mTOR-driven pathway in KRAS-mutant non-small cell lung cancer.Oncotarget. 2018 Aug 3;9(60):31572-31589. doi: 10.18632/oncotarget.25803. eCollection 2018 Aug 3.
• [21] Relation Between Lead Exposure and Trends in Blood Pressure in Children.Am J Cardiol. 2018 Dec 1;122(11):1890-1895. doi: 10.1016/j.amjcard.2018.08.033. Epub 2018 Sep 7.
• [22] ERK/MAP Kinase Activation is Evident in Activated Microglia of the Striatum and Substantia Nigra in an Acute and Chronically-Induced Mouse Model of Parkinson's Disease.Curr Neurovasc Res. 2018;15(4):336-344. doi: 10.2174/1567202616666181123152601.
• [23] Growth Factor-like Gene Regulation Is Separable from Survival and Maturation in Antibody-Secreting Cells.J Immunol. 2019 Feb 15;202(4):1287-1300. doi: 10.4049/jimmunol.1801407. Epub 2019 Jan 14.
• [24] Mer Tyrosine Kinase Regulates Disseminated Prostate Cancer Cellular Dormancy.J Cell Biochem. 2017 Apr;118(4):891-902. doi: 10.1002/jcb.25768. Epub 2016 Nov 10.
• [25] The RA-MAP Consortium: a working model for academia-industry collaboration.Nat Rev Rheumatol. 2018 Jan;14(1):53-60. doi: 10.1038/nrrheum.2017.200. Epub 2017 Dec 7.
• [26] Blood pressure predictors of stroke in rural Chinese dwellers with hypertension: a large-scale prospective cohort study.BMC Cardiovasc Disord. 2019 Aug 29;19(1):206. doi: 10.1186/s12872-019-1186-0.
• [27] AhR-ROR-t complex is a therapeutic target for MAP4K3/GLK(high)IL-17A(high) subpopulation of systemic lupus erythematosus.FASEB J. 2019 Oct;33(10):11469-11480. doi: 10.1096/fj.201900105RR. Epub 2019 Aug 1.
• [28] Loss of Tau results in defects in photoreceptor development and progressive neuronal degeneration in Drosophila.Dev Neurobiol. 2014 Dec;74(12):1210-25. doi: 10.1002/dneu.22199. Epub 2014 Jun 18.
• [29] Sustained activation of the AKT/mTOR and MAP kinase pathways mediate resistance to the Src inhibitor, dasatinib, in thyroid cancer.Oncotarget. 2017 Aug 24;8(61):103014-103031. doi: 10.18632/oncotarget.20488. eCollection 2017 Nov 28.
• [30] Complex TNF- B cell epitope MAP vaccine alleviates murine ulcerative colitis.Int J Mol Med. 2019 Sep;44(3):1106-1116. doi: 10.3892/ijmm.2019.4271. Epub 2019 Jul 8.
• [31] Stabilization of NF-B-Inducing Kinase Suppresses MLL-AF9-Induced Acute Myeloid Leukemia.Cell Rep. 2018 Jan 9;22(2):350-358. doi: 10.1016/j.celrep.2017.12.055.
• [32] Concurrent occurrence of an inherited 16p13.11 microduplication and a de novo 19p13.3 microdeletion involving MAP2K2 in a patient with developmental delay, distinctive facial features, and lambdoid synostosis.Eur J Med Genet. 2016 Nov;59(11):559-563. doi: 10.1016/j.ejmg.2016.10.006. Epub 2016 Oct 14.
• [33] Role of BRAF in thyroid oncogenesis.Clin Cancer Res. 2011 Dec 15;17(24):7511-7. doi: 10.1158/1078-0432.CCR-11-1155. Epub 2011 Sep 7.
• [34] A novel approach for targeted elimination of CSPG4-positive triple-negative breast cancer cells using a MAP tau-based fusion protein.Int J Cancer. 2016 Aug 15;139(4):916-27. doi: 10.1002/ijc.30119. Epub 2016 Apr 15.
• [35] The interleukin-33-mediated inhibition of expression of two key genes implicated in atherosclerosis in human macrophages requires MAP kinase, phosphoinositide 3-kinase and nuclear factor-B signaling pathways.Sci Rep. 2019 Aug 5;9(1):11317. doi: 10.1038/s41598-019-47620-8.
• [36] SMYD3 links lysine methylation of MAP3K2 to Ras-driven cancer.Nature. 2014 Jun 12;510(7504):283-7. doi: 10.1038/nature13320. Epub 2014 May 21.
• [37] MAPK1/ERK2 as novel target genes for pain in head and neck cancer patients.BMC Genet. 2016 Feb 13;17:40. doi: 10.1186/s12863-016-0348-7.
• [38] SWOG S1400D (NCT02965378), a Phase II Study ofthe Fibroblast Growth Factor Receptor Inhibitor AZD4547 in Previously Treated Patients With Fibroblast Growth Factor Pathway-Activated StageIV Squamous Cell Lung Cancer (Lung-MAPSubstudy).J Thorac Oncol. 2019 Oct;14(10):1847-1852. doi: 10.1016/j.jtho.2019.05.041. Epub 2019 Jun 11.
• [39] Reverting chemoresistance of targeted agents by a ultrasoluble dendritic nanocapsule.J Control Release. 2020 Jan 10;317:67-77. doi: 10.1016/j.jconrel.2019.11.020. Epub 2019 Nov 19.
• [40] Mps1 is associated with the BRAF(V600E) mutation but does not rely on the classic RAS/RAF/MEK/ERK signaling pathway in thyroid carcinoma.Oncol Lett. 2018 Jun;15(6):9978-9986. doi: 10.3892/ol.2018.8561. Epub 2018 Apr 24.
• [41] Cardiac effects of fish oil in a rat model of streptozotocin-induced diabetes.Nutr Metab Cardiovasc Dis. 2018 Jun;28(6):592-599. doi: 10.1016/j.numecd.2018.02.012. Epub 2018 Feb 25.
• [42] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [43] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [44] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [45] Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
• [46] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [47] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.