Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLB2WEU)

• DOT Name: Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3)
• Synonyms: EC 1.11.1.24; Antioxidant protein 1; AOP-1; HBC189; Peroxiredoxin III; Prx-III; Peroxiredoxin-3; Protein MER5 homolog; Thioredoxin-dependent peroxiredoxin 3
• Gene Name: PRDX3
• Related Disease:
  Cervical cancer
  Cervical carcinoma
  Lung carcinoma
  Acute erythroid leukemia
  Acute myelogenous leukaemia
  Advanced cancer
  Alzheimer disease
  Anterior horn disorder
  Benign prostatic hyperplasia
  Breast cancer
  Breast carcinoma
  Cardiac failure
  Cardiovascular disease
  Chronic kidney disease
  Clear cell renal carcinoma
  Colon cancer
  Colon carcinoma
  Colonic neoplasm
  Corneal dystrophy, punctiform and polychromatic pre-descemet
  Hepatocellular carcinoma
  Hereditary motor neuron disease
  Hyperinsulinemia
  Lateral sclerosis
  Lung adenocarcinoma
  Lung cancer
  Malignant mesothelioma
  Medulloblastoma
  Multiple sclerosis
  Neoplasm
  Nervous system inflammation
  Obesity
  Osteoporosis
  Promyelocytic leukaemia
  Prostate cancer
  Prostate carcinoma
  Spinocerebellar ataxia, autosomal recessive 32
  Ulcerative colitis
  Uveal Melanoma
  Laryngeal squamous cell carcinoma
  Polycystic ovarian syndrome
  Squamous cell carcinoma
  Endometrial cancer
  Endometrial carcinoma
  B-cell lymphoma
  Motor neurone disease
  Nasopharyngeal carcinoma
  Neuroblastoma
  Parkinson disease
• UniProt ID: PRDX3_HUMAN
• PDB ID: 5JCG; 5UCX
• EC Number: 1.11.1.24
• Pfam ID: PF10417 ; PF00578
• Sequence:
  MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSC
  HAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKAN
  EFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSG
  LALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTI
  KPSPAASKEYFQKVNQ
• Function: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. Acts synergistically with MAP3K13 to regulate the activation of NF-kappa-B in the cytosol. Required for the maintenance of physical strength.
• Reactome Pathway: Detoxification of Reactive Oxygen Species (R-HSA-3299685)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cervical cancer	DISFSHPF	Definitive	Genetic Variation	[1]
Cervical carcinoma	DIST4S00	Definitive	Genetic Variation	[1]
Lung carcinoma	DISTR26C	Definitive	Biomarker	[2]
Acute erythroid leukemia	DISZFC1O	Strong	Altered Expression	[3]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[4]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[5]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[6]
Anterior horn disorder	DISF6XLX	Strong	Biomarker	[7]
Benign prostatic hyperplasia	DISI3CW2	Strong	Altered Expression	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Cardiac failure	DISDC067	Strong	Altered Expression	[10]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[11]
Chronic kidney disease	DISW82R7	Strong	Biomarker	[12]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[13]
Colon cancer	DISVC52G	Strong	Biomarker	[14]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[14]
Colonic neoplasm	DISSZ04P	Strong	Altered Expression	[15]
Corneal dystrophy, punctiform and polychromatic pre-descemet	DISAXDXQ	Strong	Autosomal dominant	[16]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[5]
Hereditary motor neuron disease	DIS6XNI0	Strong	Biomarker	[7]
Hyperinsulinemia	DISIDWT6	Strong	Biomarker	[17]
Lateral sclerosis	DISH30B8	Strong	Biomarker	[7]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[18]
Lung cancer	DISCM4YA	Strong	Altered Expression	[5]
Malignant mesothelioma	DISTHJGH	Strong	Altered Expression	[19]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[20]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[21]
Neoplasm	DISZKGEW	Strong	Biomarker	[22]
Nervous system inflammation	DISB3X5A	Strong	Altered Expression	[23]
Obesity	DIS47Y1K	Strong	Genetic Variation	[24]
Osteoporosis	DISF2JE0	Strong	Biomarker	[25]
Promyelocytic leukaemia	DISYGG13	Strong	Altered Expression	[26]
Prostate cancer	DISF190Y	Strong	Biomarker	[27]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[27]
Spinocerebellar ataxia, autosomal recessive 32	DISQM54F	Strong	Autosomal recessive	[28]
Ulcerative colitis	DIS8K27O	Strong	Altered Expression	[29]
Uveal Melanoma	DISA7ZGL	Strong	Biomarker	[2]
Laryngeal squamous cell carcinoma	DIS9UUVF	moderate	Biomarker	[30]
Polycystic ovarian syndrome	DISZ2BNG	moderate	Altered Expression	[31]
Squamous cell carcinoma	DISQVIFL	moderate	Altered Expression	[32]
Endometrial cancer	DISW0LMR	Disputed	Biomarker	[33]
Endometrial carcinoma	DISXR5CY	Disputed	Biomarker	[33]
B-cell lymphoma	DISIH1YQ	Limited	Biomarker	[34]
Motor neurone disease	DISUHWUI	Limited	Biomarker	[7]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Biomarker	[35]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[36]
Parkinson disease	DISQVHKL	Limited	Biomarker	[36]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Sulforaphane	DMQY3L0	Investigative	Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3) affects the binding of Sulforaphane.	[61]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[37]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[38]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[39]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[40]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[41]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[42]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[26]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[44]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[45]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[46]
Dopamine	DMPGUCF	Approved	Dopamine increases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[47]
Aminoglutethimide	DMWFHMZ	Approved	Aminoglutethimide increases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[48]
DNCB	DMDTVYC	Phase 2	DNCB decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[49]
Eugenol	DM7US1H	Patented	Eugenol decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[49]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[52]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[53]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[54]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[55]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[56]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[57]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[44]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Triapine	DM7XZY5	Phase 2	Triapine increases the oxidation of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[50]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[51]
acrolein	DMAMCSR	Investigative	acrolein increases the oxidation of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[59]
Diamide	DMOCQ9J	Investigative	Diamide increases the oxidation of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[60]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone affects the localization of Thioredoxin-dependent peroxide reductase, mitochondrial (PRDX3).	[58]

References

• [1] Single nucleotide polymorphisms in the PRDX3 and RPS19 and risk of HPV persistence and cervical precancer/cancer.PLoS One. 2012;7(4):e33619. doi: 10.1371/journal.pone.0033619. Epub 2012 Apr 9.
• [2] PRDX3 is associated with metastasis and poor survival in uveal melanoma.J Clin Pathol. 2020 Jul;73(7):408-412. doi: 10.1136/jclinpath-2019-206173. Epub 2019 Nov 26.
• [3] A human cDNA corresponding to a gene overexpressed during cell proliferation encodes a product sharing homology with amoebic and bacterial proteins.J Biol Chem. 1993 May 25;268(15):11050-6.
• [4] MicroRNA-26a-5p and microRNA-23b-3p up-regulate peroxiredoxin III in acute myeloid leukemia.Leuk Lymphoma. 2015 Feb;56(2):460-71. doi: 10.3109/10428194.2014.924115. Epub 2014 Jun 25.
• [5] Interplay Between Mitochondrial Peroxiredoxins and ROS in Cancer Development and Progression.Int J Mol Sci. 2019 Sep 7;20(18):4407. doi: 10.3390/ijms20184407.
• [6] Protein levels of human peroxiredoxin subtypes in brains of patients with Alzheimer's disease and Down syndrome.J Neural Transm Suppl. 2001;(61):223-35. doi: 10.1007/978-3-7091-6262-0_18.
• [7] Impairment of mitochondrial anti-oxidant defence in SOD1-related motor neuron injury and amelioration by ebselen. Brain. 2006 Jul;129(Pt 7):1693-709. doi: 10.1093/brain/awl118. Epub 2006 May 15.
• [8] Mitochondrion-associated protein peroxiredoxin 3 promotes benign prostatic hyperplasia through autophagy suppression and pyroptosis activation.Oncotarget. 2017 May 17;8(46):80295-80302. doi: 10.18632/oncotarget.17927. eCollection 2017 Oct 6.
• [9] Silencing the Peroxiredoxin III gene inhibits cell proliferation in breast cancer.Int J Oncol. 2010 Feb;36(2):359-64.
• [10] Oxidative stress and mitochondrial DNA damage in heart failure.Circ J. 2008;72 Suppl A:A31-7. doi: 10.1253/circj.cj-08-0014. Epub 2008 Sep 4.
• [11] Epigenetic Regulatory Effect of Exercise on Glutathione Peroxidase 1 Expression in the Skeletal Muscle of Severely Dyslipidemic Mice.PLoS One. 2016 Mar 24;11(3):e0151526. doi: 10.1371/journal.pone.0151526. eCollection 2016.
• [12] Tubular Peroxiredoxin 3 as a Predictor of Renal Recovery from Acute Tubular Necrosis in Patients with Chronic Kidney Disease.Sci Rep. 2017 Feb 27;7:43589. doi: 10.1038/srep43589.
• [13] Hypoxia inducible factor-1 suppresses Peroxiredoxin 3 expression to promote proliferation of CCRCC cells.FEBS Lett. 2014 Sep 17;588(18):3390-4. doi: 10.1016/j.febslet.2014.07.030. Epub 2014 Aug 2.
• [14] Mitochondrial metabolism in cancer stem cells: a therapeutic target for colon cancer.BMB Rep. 2015 Oct;48(10):539-40. doi: 10.5483/bmbrep.2015.48.10.179.
• [15] FOXM1-Induced PRX3 Regulates Stemness and Survival of Colon Cancer Cells via Maintenance of Mitochondrial Function.Gastroenterology. 2015 Oct;149(4):1006-16.e9. doi: 10.1053/j.gastro.2015.06.007. Epub 2015 Jun 17.
• [16] Punctiform and Polychromatic Pre-Descemet Corneal Dystrophy: Clinical Evaluation and Identification of the Genetic Basis. Am J Ophthalmol. 2020 Apr;212:88-97. doi: 10.1016/j.ajo.2019.11.024. Epub 2019 Nov 27.
• [17] The association of plasma peroxiredoxin 3 with insulin in pregnant women.Biochem Biophys Res Commun. 2019 Jan 15;508(3):805-810. doi: 10.1016/j.bbrc.2018.12.021. Epub 2018 Dec 7.
• [18] DACH1 inhibits the proliferation and invasion of lung adenocarcinoma through the downregulation of peroxiredoxin 3.Tumour Biol. 2016 Jul;37(7):9781-8. doi: 10.1007/s13277-016-4811-x. Epub 2016 Jan 25.
• [19] Peroxiredoxin 3 levels regulate a mitochondrial redox setpoint in malignant mesothelioma cells.Redox Biol. 2014;3:79-87. doi: 10.1016/j.redox.2014.11.003. Epub 2014 Nov 18.
• [20] MiR-383 is downregulated in medulloblastoma and targets peroxiredoxin 3 (PRDX3).Brain Pathol. 2013 Jul;23(4):413-25. doi: 10.1111/bpa.12014. Epub 2013 Jan 9.
• [21] Astroglial PGC-1alpha increases mitochondrial antioxidant capacity and suppresses inflammation: implications for multiple sclerosis.Acta Neuropathol Commun. 2014 Dec 10;2:170. doi: 10.1186/s40478-014-0170-2.
• [22] Peroxiredoxin III Protects Tumor Suppressor PTEN from Oxidation by 15-Hydroperoxy-eicosatetraenoic Acid.Oxid Med Cell Longev. 2019 Sep 15;2019:2828493. doi: 10.1155/2019/2828493. eCollection 2019.
• [23] Up-regulation of PGC-1 in neurons protects against experimental autoimmune encephalomyelitis.FASEB J. 2019 Dec;33(12):14811-14824. doi: 10.1096/fj.201901149RR. Epub 2019 Nov 13.
• [24] The combination of genetic variations in the PRDX3 gene and dietary fat intake contribute to obesity risk.Obesity (Silver Spring). 2011 Apr;19(4):882-7. doi: 10.1038/oby.2010.275. Epub 2010 Dec 2.
• [25] Proteomic analysis of circulating monocytes in Chinese premenopausal females with extremely discordant bone mineral density.Proteomics. 2008 Oct;8(20):4259-72. doi: 10.1002/pmic.200700480.
• [26] Downregulation of the c-MYC target gene, peroxiredoxin III, contributes to arsenic trioxide-induced apoptosis in acute promyelocytic leukemia. Int J Cancer. 2009 Jul 15;125(2):264-75. doi: 10.1002/ijc.24341.
• [27] Peroxiredoxins 3 and 4 are overexpressed in prostate cancer tissue and affect the proliferation of prostate cancer cells in vitro.J Proteome Res. 2012 Apr 6;11(4):2452-66. doi: 10.1021/pr201172n. Epub 2012 Mar 28.
• [28] Biallelic loss-of-function variations in PRDX3 cause cerebellar ataxia. Brain. 2021 Jun 22;144(5):1467-1481. doi: 10.1093/brain/awab071.
• [29] Casticin prevents DSS induced ulcerative colitis in mice through inhibitions of NF-B pathway and ROS signaling.Phytother Res. 2018 Sep;32(9):1770-1783. doi: 10.1002/ptr.6108. Epub 2018 Jun 7.
• [30] Differential expression of peroxiredoxin 3 in laryngeal squamous cell carcinoma.Oncotarget. 2017 Jan 10;8(2):3471-3480. doi: 10.18632/oncotarget.13838.
• [31] Plasma level of peroxiredoxin 3 in patients with polycystic ovarian syndrome.BMC Endocr Disord. 2019 Mar 14;19(1):32. doi: 10.1186/s12902-019-0358-3.
• [32] Nuclear factor E2-related factor 2 dependent overexpression of sulfiredoxin and peroxiredoxin III in human lung cancer.Korean J Intern Med. 2011 Sep;26(3):304-13. doi: 10.3904/kjim.2011.26.3.304. Epub 2011 Sep 13.
• [33] Overexpression of peroxiredoxin-3 and -5 is a potential biomarker for prognosis in endometrial cancer.Oncol Lett. 2018 Apr;15(4):5111-5118. doi: 10.3892/ol.2018.7909. Epub 2018 Jan 31.
• [34] A redox signature score identifies diffuse large B-cell lymphoma patients with a poor prognosis.Blood. 2005 Nov 15;106(10):3594-601. doi: 10.1182/blood-2005-02-0487. Epub 2005 Aug 4.
• [35] Serum proteomic-based analysis identifying autoantibodies against PRDX2 and PRDX3 as potential diagnostic biomarkers in nasopharyngeal carcinoma.Clin Proteomics. 2017 Feb 1;14:6. doi: 10.1186/s12014-017-9141-5. eCollection 2017.
• [36] Silencing of peroxiredoxin 3 and peroxiredoxin 5 reveals the role of mitochondrial peroxiredoxins in the protection of human neuroblastoma SH-SY5Y cells toward MPP+.Neurosci Lett. 2008 Mar 15;433(3):219-24. doi: 10.1016/j.neulet.2007.12.068. Epub 2008 Jan 17.
• [37] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [38] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [39] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [40] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [41] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [42] Quercetin induces the expression of peroxiredoxins 3 and 5 via the Nrf2/NRF1 transcription pathway. Invest Ophthalmol Vis Sci. 2011 Feb 22;52(2):1055-63. doi: 10.1167/iovs.10-5777.
• [43] Downregulation of the c-MYC target gene, peroxiredoxin III, contributes to arsenic trioxide-induced apoptosis in acute promyelocytic leukemia. Int J Cancer. 2009 Jul 15;125(2):264-75. doi: 10.1002/ijc.24341.
• [44] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [45] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [46] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [47] Mitochondrial proteomics investigation of a cellular model of impaired dopamine homeostasis, an early step in Parkinson's disease pathogenesis. Mol Biosyst. 2014 Jun;10(6):1332-44.
• [48] Proteomic profile of aminoglutethimide-induced apoptosis in HL-60 cells: role of myeloperoxidase and arylamine free radicals. Chem Biol Interact. 2015 Sep 5;239:129-38.
• [49] Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
• [50] The iron-chelating drug triapine causes pronounced mitochondrial thiol redox stress. Toxicol Lett. 2011 Mar 5;201(2):130-6. doi: 10.1016/j.toxlet.2010.12.017. Epub 2010 Dec 31.
• [51] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [52] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [53] Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.
• [54] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
• [55] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [56] Quercetin reduces oxidative damage induced by paraquat via modulating expression of antioxidant genes in A549 cells. J Appl Toxicol. 2013 Dec;33(12):1460-7. doi: 10.1002/jat.2812. Epub 2012 Sep 20.
• [57] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [58] Labeling and identification of LNCaP cell surface proteins: a pilot study. Prostate. 2007 Jun 15;67(9):943-54. doi: 10.1002/pros.20580.
• [59] The effects of acrolein on peroxiredoxins, thioredoxins, and thioredoxin reductase in human bronchial epithelial cells. Toxicology. 2009 Mar 4;257(1-2):95-104.
• [60] Mitochondrial Thioredoxin System as a Modulator of Cyclophilin D Redox State. Sci Rep. 2016 Mar 15;6:23071. doi: 10.1038/srep23071.
• [61] Identification of potential protein targets of isothiocyanates by proteomics. Chem Res Toxicol. 2011 Oct 17;24(10):1735-43. doi: 10.1021/tx2002806. Epub 2011 Aug 26.