General Information of Drug Off-Target (DOT) (ID: OTRC5K9O)

DOT Name Bcl-2-like protein 1 (BCL2L1)
Synonyms Bcl2-L-1; Apoptosis regulator Bcl-X
Gene Name BCL2L1
UniProt ID
B2CL1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1BXL ; 1G5J ; 1LXL ; 1MAZ ; 1R2D ; 1R2E ; 1R2G ; 1R2H ; 1R2I ; 1YSG ; 1YSI ; 1YSN ; 2B48 ; 2LP8 ; 2LPC ; 2M03 ; 2M04 ; 2ME8 ; 2ME9 ; 2MEJ ; 2O1Y ; 2O2M ; 2O2N ; 2P1L ; 2PON ; 2YJ1 ; 2YQ6 ; 2YQ7 ; 2YXJ ; 3CVA ; 3FDL ; 3FDM ; 3INQ ; 3IO8 ; 3PL7 ; 3QKD ; 3R85 ; 3SP7 ; 3SPF ; 3WIZ ; 3ZK6 ; 3ZLN ; 3ZLO ; 3ZLR ; 4A1U ; 4A1W ; 4AQ3 ; 4BPK ; 4C52 ; 4C5D ; 4CIN ; 4EHR ; 4HNJ ; 4IEH ; 4PPI ; 4QVE ; 4QVF ; 4QVX ; 4TUH ; 4Z9V ; 5AGW ; 5AGX ; 5B1Z ; 5C3G ; 5FMJ ; 5FMK ; 5VAY ; 5VX3 ; 6BF2 ; 6DCN ; 6DCO ; 6F46 ; 6HJL ; 6IJQ ; 6LHD ; 6O0K ; 6O0L ; 6O0M ; 6O0O ; 6O0P ; 6RNU ; 6ST2 ; 6UVC ; 6UVD ; 6UVE ; 6UVF ; 6UVG ; 6UVH ; 6VWC ; 6X7I ; 6YLI ; 6ZHC ; 7CA4 ; 7JGV ; 7JGW ; 7LH7 ; 7XGF ; 7XGG ; 7Y8D ; 7YAA ; 8U27
Pfam ID
PF00452 ; PF02180
Sequence
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Function
Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage-dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane. Also acts as a regulator of G2 checkpoint and progression to cytokinesis during mitosis.; Isoform Bcl-X(L) also regulates presynaptic plasticity, including neurotransmitter release and recovery, number of axonal mitochondria as well as size and number of synaptic vesicle clusters. During synaptic stimulation, increases ATP availability from mitochondria through regulation of mitochondrial membrane ATP synthase F(1)F(0) activity and regulates endocytic vesicle retrieval in hippocampal neurons through association with DMN1L and stimulation of its GTPase activity in synaptic vesicles. May attenuate inflammation impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release ; Isoform Bcl-X(S) promotes apoptosis.
Tissue Specificity
Bcl-X(S) is expressed at high levels in cells that undergo a high rate of turnover, such as developing lymphocytes. In contrast, Bcl-X(L) is found in tissues containing long-lived postmitotic cells, such as adult brain.
KEGG Pathway
EGFR tyrosine ki.se inhibitor resistance (hsa01521 )
Platinum drug resistance (hsa01524 )
Ras sig.ling pathway (hsa04014 )
NF-kappa B sig.ling pathway (hsa04064 )
p53 sig.ling pathway (hsa04115 )
Mitophagy - animal (hsa04137 )
Autophagy - animal (hsa04140 )
PI3K-Akt sig.ling pathway (hsa04151 )
Apoptosis (hsa04210 )
Apoptosis - multiple species (hsa04215 )
NOD-like receptor sig.ling pathway (hsa04621 )
JAK-STAT sig.ling pathway (hsa04630 )
Parkinson disease (hsa05012 )
Amyotrophic lateral sclerosis (hsa05014 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Shigellosis (hsa05131 )
Toxoplasmosis (hsa05145 )
Measles (hsa05162 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Herpes simplex virus 1 infection (hsa05168 )
Human immunodeficiency virus 1 infection (hsa05170 )
Pathways in cancer (hsa05200 )
Transcriptio.l misregulation in cancer (hsa05202 )
Pancreatic cancer (hsa05212 )
Chronic myeloid leukemia (hsa05220 )
Small cell lung cancer (hsa05222 )
Hepatocellular carcinoma (hsa05225 )
Lipid and atherosclerosis (hsa05417 )
Reactome Pathway
Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )
The NLRP1 inflammasome (R-HSA-844455 )
RAS processing (R-HSA-9648002 )
SARS-CoV-1-mediated effects on programmed cell death (R-HSA-9692913 )
STAT5 activation downstream of FLT3 ITD mutants (R-HSA-9702518 )
NFE2L2 regulating tumorigenic genes (R-HSA-9818030 )
BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members (R-HSA-111453 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 9 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Etoposide DMNH3PG Approved Bcl-2-like protein 1 (BCL2L1) decreases the response to substance of Etoposide. [96]
Docetaxel DMDI269 Approved Bcl-2-like protein 1 (BCL2L1) decreases the response to substance of Docetaxel. [97]
Rhucin DM3ADGP Approved Bcl-2-like protein 1 (BCL2L1) affects the response to substance of Rhucin. [98]
Camptothecin DM6CHNJ Phase 3 Bcl-2-like protein 1 (BCL2L1) decreases the response to substance of Camptothecin. [99]
Geldanamycin DMS7TC5 Discontinued in Phase 2 Bcl-2-like protein 1 (BCL2L1) decreases the response to substance of Geldanamycin. [100]
Trichostatin A DM9C8NX Investigative Bcl-2-like protein 1 (BCL2L1) decreases the response to substance of Trichostatin A. [100]
Nickel chloride DMI12Y8 Investigative Bcl-2-like protein 1 (BCL2L1) decreases the response to substance of Nickel chloride. [101]
Staurosporine DM0E9BR Investigative Bcl-2-like protein 1 (BCL2L1) decreases the response to substance of Staurosporine. [96]
10-hydroxycamptothecin DM9WLN4 Investigative Bcl-2-like protein 1 (BCL2L1) decreases the response to substance of 10-hydroxycamptothecin. [102]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Bcl-2-like protein 1 (BCL2L1). [1]
------------------------------------------------------------------------------------
99 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Bcl-2-like protein 1 (BCL2L1). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [6]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Bcl-2-like protein 1 (BCL2L1). [7]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of Bcl-2-like protein 1 (BCL2L1). [8]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [9]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Bcl-2-like protein 1 (BCL2L1). [10]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Bcl-2-like protein 1 (BCL2L1). [11]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Bcl-2-like protein 1 (BCL2L1). [12]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Bcl-2-like protein 1 (BCL2L1). [13]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Bcl-2-like protein 1 (BCL2L1). [14]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Bcl-2-like protein 1 (BCL2L1). [15]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Bcl-2-like protein 1 (BCL2L1). [16]
Decitabine DMQL8XJ Approved Decitabine decreases the expression of Bcl-2-like protein 1 (BCL2L1). [17]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Bcl-2-like protein 1 (BCL2L1). [18]
Selenium DM25CGV Approved Selenium increases the expression of Bcl-2-like protein 1 (BCL2L1). [19]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Bcl-2-like protein 1 (BCL2L1). [20]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Bcl-2-like protein 1 (BCL2L1). [21]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of Bcl-2-like protein 1 (BCL2L1). [22]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of Bcl-2-like protein 1 (BCL2L1). [23]
Isotretinoin DM4QTBN Approved Isotretinoin increases the expression of Bcl-2-like protein 1 (BCL2L1). [24]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Bcl-2-like protein 1 (BCL2L1). [25]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of Bcl-2-like protein 1 (BCL2L1). [26]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the expression of Bcl-2-like protein 1 (BCL2L1). [27]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of Bcl-2-like protein 1 (BCL2L1). [28]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of Bcl-2-like protein 1 (BCL2L1). [29]
Aspirin DM672AH Approved Aspirin increases the expression of Bcl-2-like protein 1 (BCL2L1). [30]
Irinotecan DMP6SC2 Approved Irinotecan decreases the expression of Bcl-2-like protein 1 (BCL2L1). [31]
Paclitaxel DMLB81S Approved Paclitaxel decreases the expression of Bcl-2-like protein 1 (BCL2L1). [32]
Diclofenac DMPIHLS Approved Diclofenac increases the expression of Bcl-2-like protein 1 (BCL2L1). [33]
Dasatinib DMJV2EK Approved Dasatinib decreases the expression of Bcl-2-like protein 1 (BCL2L1). [34]
DTI-015 DMXZRW0 Approved DTI-015 decreases the expression of Bcl-2-like protein 1 (BCL2L1). [35]
Indomethacin DMSC4A7 Approved Indomethacin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [36]
Mitomycin DMH0ZJE Approved Mitomycin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [37]
Azacitidine DMTA5OE Approved Azacitidine affects the expression of Bcl-2-like protein 1 (BCL2L1). [38]
Simvastatin DM30SGU Approved Simvastatin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [39]
Gemcitabine DMSE3I7 Approved Gemcitabine decreases the expression of Bcl-2-like protein 1 (BCL2L1). [40]
Fenofibrate DMFKXDY Approved Fenofibrate decreases the expression of Bcl-2-like protein 1 (BCL2L1). [41]
Rifampicin DM5DSFZ Approved Rifampicin increases the expression of Bcl-2-like protein 1 (BCL2L1). [42]
Sulindac DM2QHZU Approved Sulindac decreases the expression of Bcl-2-like protein 1 (BCL2L1). [36]
Capsaicin DMGMF6V Approved Capsaicin increases the expression of Bcl-2-like protein 1 (BCL2L1). [43]
Methamphetamine DMPM4SK Approved Methamphetamine decreases the expression of Bcl-2-like protein 1 (BCL2L1). [44]
Acocantherin DM7JT24 Approved Acocantherin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [45]
Thalidomide DM70BU5 Approved Thalidomide decreases the expression of Bcl-2-like protein 1 (BCL2L1). [46]
Liothyronine DM6IR3P Approved Liothyronine increases the expression of Bcl-2-like protein 1 (BCL2L1). [47]
Bicalutamide DMZMSPF Approved Bicalutamide decreases the expression of Bcl-2-like protein 1 (BCL2L1). [48]
Sorafenib DMS8IFC Approved Sorafenib decreases the expression of Bcl-2-like protein 1 (BCL2L1). [49]
Imatinib DM7RJXL Approved Imatinib decreases the expression of Bcl-2-like protein 1 (BCL2L1). [50]
Ritonavir DMU764S Approved Ritonavir decreases the expression of Bcl-2-like protein 1 (BCL2L1). [51]
Dactinomycin DM2YGNW Approved Dactinomycin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [52]
Cholecalciferol DMGU74E Approved Cholecalciferol increases the expression of Bcl-2-like protein 1 (BCL2L1). [53]
Nitric Oxide DM1RBYG Approved Nitric Oxide decreases the expression of Bcl-2-like protein 1 (BCL2L1). [54]
Isoproterenol DMK7MEY Approved Isoproterenol decreases the expression of Bcl-2-like protein 1 (BCL2L1). [55]
Glucosamine DM4ZLFD Approved Glucosamine decreases the expression of Bcl-2-like protein 1 (BCL2L1). [56]
Adenosine DMM2NSK Approved Adenosine decreases the expression of Bcl-2-like protein 1 (BCL2L1). [57]
Gentamicin DMKINJO Approved Gentamicin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [58]
Phenylephrine DMZHUO5 Approved Phenylephrine decreases the expression of Bcl-2-like protein 1 (BCL2L1). [59]
Teriflunomide DMQ2FKJ Approved Teriflunomide decreases the expression of Bcl-2-like protein 1 (BCL2L1). [60]
Ethacrynic acid DM60QMR Approved Ethacrynic acid increases the expression of Bcl-2-like protein 1 (BCL2L1). [61]
Amsacrine DMZKYIV Approved Amsacrine decreases the expression of Bcl-2-like protein 1 (BCL2L1). [62]
Fludarabine DMVRLT7 Approved Fludarabine decreases the expression of Bcl-2-like protein 1 (BCL2L1). [63]
Mercaptopurine DMTM2IK Approved Mercaptopurine decreases the expression of Bcl-2-like protein 1 (BCL2L1). [29]
Ibrutinib DMHZCPO Approved Ibrutinib decreases the expression of Bcl-2-like protein 1 (BCL2L1). [64]
Cetrorelix DMFD9Q6 Approved Cetrorelix decreases the expression of Bcl-2-like protein 1 (BCL2L1). [65]
Thiotepa DMIZKOP Approved Thiotepa increases the expression of Bcl-2-like protein 1 (BCL2L1). [66]
Promethazine DM6I5GR Approved Promethazine decreases the expression of Bcl-2-like protein 1 (BCL2L1). [67]
Dextroamphetamine DMMIHVP Approved Dextroamphetamine decreases the expression of Bcl-2-like protein 1 (BCL2L1). [44]
Venetoclax DM8I94Y Approved Venetoclax decreases the expression of Bcl-2-like protein 1 (BCL2L1). [68]
Oxybuprocaine DMI0GDH Approved Oxybuprocaine decreases the expression of Bcl-2-like protein 1 (BCL2L1). [69]
Diazoxide DML1538 Approved Diazoxide increases the expression of Bcl-2-like protein 1 (BCL2L1). [70]
Fedratinib DM4ZBK6 Approved Fedratinib increases the expression of Bcl-2-like protein 1 (BCL2L1). [71]
Berberine DMC5Q8X Phase 4 Berberine decreases the expression of Bcl-2-like protein 1 (BCL2L1). [72]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Bcl-2-like protein 1 (BCL2L1). [73]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [74]
Fenretinide DMRD5SP Phase 3 Fenretinide decreases the expression of Bcl-2-like protein 1 (BCL2L1). [75]
Rigosertib DMOSTXF Phase 3 Rigosertib decreases the expression of Bcl-2-like protein 1 (BCL2L1). [76]
I3C DMIGFOR Phase 3 I3C decreases the expression of Bcl-2-like protein 1 (BCL2L1). [77]
MLN4924 DMP36KD Phase 3 MLN4924 affects the expression of Bcl-2-like protein 1 (BCL2L1). [78]
Rebamipide DM2GHCR Phase 3 Rebamipide increases the expression of Bcl-2-like protein 1 (BCL2L1). [79]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Bcl-2-like protein 1 (BCL2L1). [80]
Thymoquinone DMVDTR2 Phase 2/3 Thymoquinone decreases the expression of Bcl-2-like protein 1 (BCL2L1). [81]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Bcl-2-like protein 1 (BCL2L1). [19]
Afimoxifene DMFORDT Phase 2 Afimoxifene increases the expression of Bcl-2-like protein 1 (BCL2L1). [82]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Bcl-2-like protein 1 (BCL2L1). [83]
PEITC DMOMN31 Phase 2 PEITC decreases the expression of Bcl-2-like protein 1 (BCL2L1). [84]
Tanespimycin DMNLQHK Phase 2 Tanespimycin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [85]
Flavopiridol DMKSUOI Phase 2 Flavopiridol decreases the expression of Bcl-2-like protein 1 (BCL2L1). [86]
Delphinidin DMS2WIN Phase 2 Delphinidin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [87]
BEZ235 DMKBRDL Phase 2 BEZ235 affects the expression of Bcl-2-like protein 1 (BCL2L1). [88]
Pelitinib DMIW453 Phase 2 Pelitinib decreases the expression of Bcl-2-like protein 1 (BCL2L1). [89]
Fucoxanthin DMPQFTA Phase 2 Fucoxanthin decreases the expression of Bcl-2-like protein 1 (BCL2L1). [90]
PF-04991532 DM94NBE Phase 2 PF-04991532 decreases the expression of Bcl-2-like protein 1 (BCL2L1). [91]
Gossypol DMJWE3I Phase 2 Gossypol decreases the expression of Bcl-2-like protein 1 (BCL2L1). [92]
Ortataxel DM1EK5D Phase 2 Ortataxel decreases the expression of Bcl-2-like protein 1 (BCL2L1). [93]
OTX-015 DMI8RG1 Phase 1/2 OTX-015 decreases the expression of Bcl-2-like protein 1 (BCL2L1). [68]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Bcl-2-like protein 1 (BCL2L1). [94]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Bcl-2-like protein 1 (BCL2L1). [95]
------------------------------------------------------------------------------------
⏷ Show the Full List of 99 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
3 Distinct role and functional mode of TR3 and RARalpha in mediating ATRA-induced signalling pathway in breast and gastric cancer cells. Int J Biochem Cell Biol. 2004 Jan;36(1):98-113. doi: 10.1016/s1357-2725(03)00143-2.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Addressing reported pro-apoptotic functions of NF-kappaB: targeted inhibition of canonical NF-kappaB enhances the apoptotic effects of doxorubicin. PLoS One. 2009 Sep 10;4(9):e6992. doi: 10.1371/journal.pone.0006992.
6 The role of RelA (p65) threonine 505 phosphorylation in the regulation of cell growth, survival, and migration. Mol Biol Cell. 2011 Sep;22(17):3032-40. doi: 10.1091/mbc.E11-04-0280. Epub 2011 Jul 7.
7 (4-Picolylamino)-17-Estradiol derivative and analogues induce apoptosis with death receptor trail R2/DR5 in MCF-7. Chem Biol Interact. 2023 Jan 5;369:110286. doi: 10.1016/j.cbi.2022.110286. Epub 2022 Nov 29.
8 Pattern of expression of apoptosis and inflammatory genes in humans exposed to arsenic and/or fluoride. Sci Total Environ. 2010 Jan 15;408(4):760-7. doi: 10.1016/j.scitotenv.2009.11.016. Epub 2009 Dec 4.
9 Quercetin potentiates apoptosis by inhibiting nuclear factor-kappaB signaling in H460 lung cancer cells. Biol Pharm Bull. 2013;36(6):944-51. doi: 10.1248/bpb.b12-01004.
10 Arsenic trioxide induces apoptosis in NB-4, an acute promyelocytic leukemia cell line, through up-regulation of p73 via suppression of nuclear factor kappa B-mediated inhibition of p73 transcription and prevention of NF-kappaB-mediated induction of XIAP, cIAP2, BCL-XL and survivin. Med Oncol. 2010 Sep;27(3):833-42. doi: 10.1007/s12032-009-9294-9. Epub 2009 Sep 10.
11 Expression of the retinoic acid-metabolizing enzyme CYP26A1 limits programmed cell death. Mol Pharmacol. 2005 May;67(5):1808-17. doi: 10.1124/mol.104.005769. Epub 2005 Feb 9.
12 Calcitriol-induced apoptosis in LNCaP cells is blocked by overexpression of Bcl-2. Endocrinology. 2000 Jan;141(1):10-7. doi: 10.1210/endo.141.1.7289.
13 Suberoylanilide hydroxamic acid (Zolinza/vorinostat) sensitizes TRAIL-resistant breast cancer cells orthotopically implanted in BALB/c nude mice. Mol Cancer Ther. 2009 Jun;8(6):1596-605. doi: 10.1158/1535-7163.MCT-08-1004. Epub 2009 Jun 9.
14 Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
15 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
16 Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
17 Growth inhibition of human cancer cells by 5-aza-2'-deoxycytidine does not correlate with its effects on INK4a/ARF expression or initial promoter methylation status. Mol Cancer Ther. 2009 Apr;8(4):779-85. doi: 10.1158/1535-7163.MCT-08-0926.
18 Effect of zoledronic acid on oral fibroblasts and epithelial cells: a potential mechanism of bisphosphonate-associated osteonecrosis. Br J Haematol. 2009 Mar;144(5):667-76. doi: 10.1111/j.1365-2141.2008.07504.x. Epub 2008 Nov 20.
19 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
20 Role of the Fas/FasL pathway in combination therapy with interferon-alpha and fluorouracil against hepatocellular carcinoma in vitro. J Hepatol. 2007 Jan;46(1):77-88. doi: 10.1016/j.jhep.2006.07.032. Epub 2006 Sep 25.
21 Dexamethasone inhibits TRAIL-induced apoptosis of thyroid cancer cells via Bcl-xL induction. Eur J Cancer. 2006 Dec;42(18):3287-93. doi: 10.1016/j.ejca.2006.07.018. Epub 2006 Oct 27.
22 Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
23 Role of miRNA in the regulation of cannabidiol-mediated apoptosis in neuroblastoma cells. Oncotarget. 2019 Jan 1;10(1):45-59. doi: 10.18632/oncotarget.26534. eCollection 2019 Jan 1.
24 Antagonism of cytotoxic chemotherapy in neuroblastoma cell lines by 13-cis-retinoic acid is mediated by the antiapoptotic Bcl-2 family proteins. Mol Cancer Ther. 2010 Dec;9(12):3164-74. doi: 10.1158/1535-7163.MCT-10-0078.
25 PS-341 (bortezomib) induces lysosomal cathepsin B release and a caspase-2-dependent mitochondrial permeabilization and apoptosis in human pancreatic cancer cells. J Biol Chem. 2006 Apr 28;281(17):11923-32. doi: 10.1074/jbc.M508533200. Epub 2006 Jan 30.
26 Increased sensitivity for troglitazone-induced cytotoxicity using a human in vitro co-culture model. Toxicol In Vitro. 2009 Oct;23(7):1387-95.
27 p38 MAPK/PP2Ac/TTP pathway on the connection of TNF- and caspases activation on hydroquinone-induced apoptosis. Carcinogenesis. 2013 Apr;34(4):818-27. doi: 10.1093/carcin/bgs409. Epub 2013 Jan 3.
28 Rosiglitazone sensitizes MDA-MB-231 breast cancer cells to anti-tumour effects of tumour necrosis factor-alpha, CH11 and CYC202. Endocr Relat Cancer. 2007 Jun;14(2):305-15. doi: 10.1677/ERC-06-0003.
29 CD28-dependent Rac1 activation is the molecular target of azathioprine in primary human CD4+ T lymphocytes. J Clin Invest. 2003 Apr;111(8):1133-45. doi: 10.1172/JCI16432.
30 Failure of apoptosis and activation on NFkappaB by celecoxib and aspirin in lung cancer cell lines. Oncol Rep. 2007 Apr;17(4):823-8.
31 Enhancement of DNA topoisomerase I inhibitor-induced apoptosis by ursodeoxycholic acid. Mol Cancer Ther. 2006 Jan;5(1):68-79. doi: 10.1158/1535-7163.MCT-05-0107.
32 Marked regression of liver metastasis by combined therapy of ultrasound-mediated NF kappaB-decoy transfer and transportal injection of paclitaxel, in mouse. Int J Cancer. 2008 Apr 1;122(7):1645-56. doi: 10.1002/ijc.23280.
33 Diclofenac induces apoptosis in hepatocytes by alteration of mitochondrial function and generation of ROS. Biochem Pharmacol. 2003 Dec 1;66(11):2155-67. doi: 10.1016/j.bcp.2003.08.003.
34 The kinase inhibitor dasatinib induces apoptosis in chronic lymphocytic leukemia cells in vitro with preference for a subgroup of patients with unmutated IgVH genes. Blood. 2008 Aug 15;112(4):1443-52. doi: 10.1182/blood-2007-11-123984. Epub 2008 Jun 12.
35 BCNU down-regulates anti-apoptotic proteins bcl-xL and Bcl-2 in association with cell death in oligodendroglioma-derived cells. J Neurooncol. 2004 Jul;68(3):233-41. doi: 10.1023/b:neon.0000033382.40601.5a.
36 Role of BAX in the apoptotic response to anticancer agents. Science. 2000 Nov 3;290(5493):989-92. doi: 10.1126/science.290.5493.989.
37 Mitomycin C induces apoptosis in cultured corneal fibroblasts derived from type II granular corneal dystrophy corneas. Mol Vis. 2008 Jun 30;14:1222-8.
38 The effect of azacitidine on interleukin-6 signaling and nuclear factor-kappaB activation and its in vitro and in vivo activity against multiple myeloma. Haematologica. 2008 Jun;93(6):860-9. doi: 10.3324/haematol.12261. Epub 2008 Apr 28.
39 Simvastatin induces apoptosis in human colon cancer cells and in tumor xenografts, and attenuates colitis-associated colon cancer in mice. Int J Cancer. 2008 Aug 15;123(4):951-7. doi: 10.1002/ijc.23593.
40 Extracellular signal-regulated kinase activation and Bcl-2 downregulation mediate apoptosis after gemcitabine treatment partly via a p53-independent pathway. Eur J Pharmacol. 2004 Oct 19;502(3):169-83. doi: 10.1016/j.ejphar.2004.09.006.
41 Fenofibrate induces effective apoptosis in mantle cell lymphoma by inhibiting the TNFalpha/NF-kappaB signaling axis. Leukemia. 2010 Aug;24(8):1476-86. doi: 10.1038/leu.2010.117. Epub 2010 Jun 3.
42 Rifampicin inhibits CD95-mediated apoptosis of Jurkat T cells via glucocorticoid receptors by modifying the expression of molecules regulating apoptosis. J Clin Immunol. 2002 Jan;22(1):37-47. doi: 10.1023/a:1014256603539.
43 Triggering of transient receptor potential vanilloid type 1 (TRPV1) by capsaicin induces Fas/CD95-mediated apoptosis of urothelial cancer cells in an ATM-dependent manner. Carcinogenesis. 2009 Aug;30(8):1320-9. doi: 10.1093/carcin/bgp138. Epub 2009 Jun 5.
44 An insight into the hepatocellular death induced by amphetamines, individually and in combination: the involvement of necrosis and apoptosis. Arch Toxicol. 2013 Dec;87(12):2165-85. doi: 10.1007/s00204-013-1082-9. Epub 2013 Jul 3.
45 Ouabain induces apoptotic cell death in human prostate DU 145 cancer cells through DNA damage and TRAIL pathways. Environ Toxicol. 2019 Dec;34(12):1329-1339. doi: 10.1002/tox.22834. Epub 2019 Aug 21.
46 NF-kappaB protects Beh?et's disease T cells against CD95-induced apoptosis up-regulating antiapoptotic proteins. Arthritis Rheum. 2005 Jul;52(7):2179-91. doi: 10.1002/art.21145.
47 3,5,3'-triiodothyronine (T3) is a survival factor for pancreatic beta-cells undergoing apoptosis. J Cell Physiol. 2006 Feb;206(2):309-21. doi: 10.1002/jcp.20460.
48 Niclosamide and Bicalutamide Combination Treatment Overcomes Enzalutamide- and Bicalutamide-Resistant Prostate Cancer. Mol Cancer Ther. 2017 Aug;16(8):1521-1530. doi: 10.1158/1535-7163.MCT-16-0912. Epub 2017 May 12.
49 Apoptosis induced by the kinase inhibitor BAY 43-9006 in human leukemia cells involves down-regulation of Mcl-1 through inhibition of translation. J Biol Chem. 2005 Oct 21;280(42):35217-27. doi: 10.1074/jbc.M506551200. Epub 2005 Aug 18.
50 The catalytic DNA topoisomerase II inhibitor dexrazoxane (ICRF-187) induces differentiation and apoptosis in human leukemia K562 cells. Mol Pharmacol. 2001 Mar;59(3):453-61. doi: 10.1124/mol.59.3.453.
51 Efficient intervention of growth and infiltration of primary adult T-cell leukemia cells by an HIV protease inhibitor, ritonavir. Blood. 2006 Jan 15;107(2):716-24. doi: 10.1182/blood-2005-02-0735. Epub 2005 Sep 20.
52 Mechanisms of thymidine kinase/ganciclovir and cytosine deaminase/ 5-fluorocytosine suicide gene therapy-induced cell death in glioma cells. Oncogene. 2005 Feb 10;24(7):1231-43. doi: 10.1038/sj.onc.1208290.
53 Vitamin D3 induces autophagy of human myeloid leukemia cells. J Biol Chem. 2008 Sep 12;283(37):25596-25605. doi: 10.1074/jbc.M801716200. Epub 2008 Jul 15.
54 Apoptotic signaling pathways induced by nitric oxide in human lymphoblastoid cells expressing wild-type or mutant p53. Cancer Res. 2004 May 1;64(9):3022-9. doi: 10.1158/0008-5472.can-03-1880.
55 Isoproterenol effects evaluated in heart slices of human and rat in comparison to rat heart in vivo. Toxicol Appl Pharmacol. 2014 Jan 15;274(2):302-12.
56 [Role of Bcl-xL in the cathepsin D-associated apoptosis of K562 cells]. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2005 Jun;13(3):379-82.
57 Adenosine-induced caspase-3 activation by tuning Bcl-XL/DIABLO/IAP expression in HuH-7 human hepatoma cells. Cell Biol Toxicol. 2010 Aug;26(4):319-30. doi: 10.1007/s10565-009-9145-7. Epub 2010 Jan 9.
58 In vitro evaluation of biomarkers of nephrotoxicity through gene expression using gentamicin. J Biochem Mol Toxicol. 2018 Sep;32(9):e22189. doi: 10.1002/jbt.22189. Epub 2018 Jul 10.
59 Phenylephrine induces necroptosis and apoptosis in corneal epithelial cells dose- and time-dependently. Toxicology. 2019 Dec 1;428:152305. doi: 10.1016/j.tox.2019.152305. Epub 2019 Oct 9.
60 Mitochondrial dysfunction induced by leflunomide and its active metabolite. Toxicology. 2018 Mar 1;396-397:33-45.
61 Ethacrynic acid and a derivative enhance apoptosis in arsenic trioxide-treated myeloid leukemia and lymphoma cells: the role of glutathione S-transferase p1-1. Clin Cancer Res. 2012 Dec 15;18(24):6690-701. doi: 10.1158/1078-0432.CCR-12-0770. Epub 2012 Oct 18.
62 Amsacrine downregulates BCL2L1 expression and triggers apoptosis in human chronic myeloid leukemia cells through the SIDT2/NOX4/ERK/HuR pathway. Toxicol Appl Pharmacol. 2023 Sep 1;474:116625. doi: 10.1016/j.taap.2023.116625. Epub 2023 Jul 13.
63 Matrix metalloproteinase-9 is involved in chronic lymphocytic leukemia cell response to fludarabine and arsenic trioxide. PLoS One. 2014 Jun 23;9(6):e99993. doi: 10.1371/journal.pone.0099993. eCollection 2014.
64 Synergistic activity of BET protein antagonist-based combinations in mantle cell lymphoma cells sensitive or resistant to ibrutinib. Blood. 2015 Sep 24;126(13):1565-74.
65 Luteinizing Hormone-Releasing Hormone (LHRH)-I antagonist cetrorelix inhibits myeloma cell growth in vitro and in vivo. Mol Cancer Ther. 2011 Jan;10(1):148-58. doi: 10.1158/1535-7163.MCT-10-0829. Epub 2010 Nov 9.
66 Susceptibility to drug-induced apoptosis correlates with differential modulation of Bad, Bcl-2 and Bcl-xL protein levels. Cell Death Differ. 2000 Jun;7(6):574-86. doi: 10.1038/sj.cdd.4400688.
67 AMPK activation induced by promethazine increases NOXA expression and Beclin-1 phosphorylation and drives autophagy-associated apoptosis in chronic myeloid leukemia. Chem Biol Interact. 2020 Jan 5;315:108888. doi: 10.1016/j.cbi.2019.108888. Epub 2019 Nov 2.
68 Superior efficacy of cotreatment with BET protein inhibitor and BCL2 or MCL1 inhibitor against AML blast progenitor cells. Blood Cancer J. 2019 Jan 15;9(2):4. doi: 10.1038/s41408-018-0165-5.
69 The cytotoxic effect of oxybuprocaine on human corneal epithelial cells by inducing cell cycle arrest and mitochondria-dependent apoptosis. Hum Exp Toxicol. 2017 Aug;36(8):765-775. doi: 10.1177/0960327116665676. Epub 2016 Sep 1.
70 Diazoxide-mediated preconditioning against apoptosis involves activation of cAMP-response element-binding protein (CREB) and NFkappaB. J Biol Chem. 2004 Nov 5;279(45):46748-54. doi: 10.1074/jbc.M406217200. Epub 2004 Aug 23.
71 Differences in gene expression and alterations in cell cycle of acute myeloid leukemia cell lines after treatment with JAK inhibitors. Eur J Pharmacol. 2015 Oct 15;765:188-97. doi: 10.1016/j.ejphar.2015.08.037. Epub 2015 Aug 20.
72 Berberine, a natural product, induces G1-phase cell cycle arrest and caspase-3-dependent apoptosis in human prostate carcinoma cells. Mol Cancer Ther. 2006 Feb;5(2):296-308. doi: 10.1158/1535-7163.MCT-05-0448.
73 Resveratrol induces apoptosis MH7A human rheumatoid arthritis synovial cells in a sirtuin 1-dependent manner. Rheumatol Int. 2012 Jan;32(1):151-7. doi: 10.1007/s00296-010-1598-8. Epub 2010 Aug 10.
74 The antitumor activities of curcumin and of its isoxazole analogue are not affected by multiple gene expression changes in an MDR model of the MCF-7 breast cancer cell line: analysis of the possible molecular basis. Int J Mol Med. 2007 Sep;20(3):329-35.
75 Retinamide-induced apoptosis in glioblastomas is associated with down-regulation of Bcl-xL and Bcl-2 proteins. J Neurooncol. 2005 Sep;74(3):225-32. doi: 10.1007/s11060-005-7305-z.
76 Styryl sulfonyl compounds inhibit translation of cyclin D1 in mantle cell lymphoma cells. Oncogene. 2009 Mar 26;28(12):1518-28. doi: 10.1038/onc.2008.502. Epub 2009 Feb 9.
77 Anticarcinogenic effect of indole-3-carbinol (I3C) on human hepatocellular carcinoma SNU449 cells. Hum Exp Toxicol. 2019 Jan;38(1):136-147. doi: 10.1177/0960327118785235. Epub 2018 Jul 11.
78 The Nedd8-activating enzyme inhibitor MLN4924 thwarts microenvironment-driven NF-B activation and induces apoptosis in chronic lymphocytic leukemia B cells. Clin Cancer Res. 2014 Mar 15;20(6):1576-89. doi: 10.1158/1078-0432.CCR-13-0987.
79 Rebamipide suppresses 5-fluorouracil-induced cell death via the activation of Akt/mTOR pathway and regulates the expression of Bcl-2 family proteins. Toxicol In Vitro. 2018 Feb;46:284-293. doi: 10.1016/j.tiv.2017.10.019. Epub 2017 Oct 17.
80 Effects of soy isoflavones on apoptosis induction and G2-M arrest in human hepatoma cells involvement of caspase-3 activation, Bcl-2 and Bcl-XL downregulation, and Cdc2 kinase activity. Nutr Cancer. 2003;45(1):113-23. doi: 10.1207/S15327914NC4501_13.
81 Thymoquinone induces apoptosis in bladder cancer cell via endoplasmic reticulum stress-dependent mitochondrial pathway. Chem Biol Interact. 2018 Aug 25;292:65-75. doi: 10.1016/j.cbi.2018.06.013. Epub 2018 Jul 2.
82 Identification of novel ER-alpha target genes in breast cancer cells: gene- and cell-selective co-regulator recruitment at target promoters determines the response to 17beta-estradiol and tamoxifen. Mol Cell Endocrinol. 2010 Jan 15;314(1):90-100.
83 Protein kinase C activation modulates pro- and anti-apoptotic signaling pathways. Eur J Cell Biol. 2000 Nov;79(11):824-33. doi: 10.1078/0171-9335-00100.
84 Effects of antioxidants and caspase-3 inhibitor on the phenylethyl isothiocyanate-induced apoptotic signaling pathways in human PLC/PRF/5 cells. Eur J Pharmacol. 2005 Aug 22;518(2-3):96-106. doi: 10.1016/j.ejphar.2005.06.021.
85 Analysis of expression of heat shock protein-90 (HSP90) and the effects of HSP90 inhibitor (17-AAG) in multiple myeloma. Leuk Lymphoma. 2006 Jul;47(7):1369-78. doi: 10.1080/10428190500472123.
86 Flavopiridol down-regulates antiapoptotic proteins and sensitizes human breast cancer cells to epothilone B-induced apoptosis. Cancer Res. 2003 Jan 1;63(1):93-9.
87 Delphinidin modulates JAK/STAT3 and MAPKinase signaling to induce apoptosis in HCT116 cells. Environ Toxicol. 2021 Aug;36(8):1557-1566. doi: 10.1002/tox.23152. Epub 2021 May 6.
88 Synergistic induction of cell death in haematological malignancies by combined phosphoinositide-3-kinase and BET bromodomain inhibition. Br J Haematol. 2015 Jul;170(2):275-8. doi: 10.1111/bjh.13283. Epub 2015 Jan 12.
89 Irreversible EGFR inhibitor EKB-569 targets low-LET -radiation-triggered rel orchestration and potentiates cell death in squamous cell carcinoma. PLoS One. 2011;6(12):e29705. doi: 10.1371/journal.pone.0029705. Epub 2011 Dec 29.
90 Fucoxanthin induces apoptosis in human leukemia HL-60 cells through a ROS-mediated Bcl-xL pathway. Toxicol In Vitro. 2010 Sep;24(6):1648-54. doi: 10.1016/j.tiv.2010.05.023. Epub 2010 Jun 8.
91 In vitro antitumor mechanism of (E)-N-(2-methoxy-5-(((2,4,6-trimethoxystyryl)sulfonyl)methyl)pyridin-3-yl)methanesulfonamide. Mol Pharmacol. 2015 Jan;87(1):18-30. doi: 10.1124/mol.114.093245. Epub 2014 Oct 14.
92 -(-)Gossypol promotes the apoptosis of bladder cancer cells in vitro. Pharmacol Res. 2008 Nov-Dec;58(5-6):323-31. doi: 10.1016/j.phrs.2008.09.005. Epub 2008 Sep 16.
93 Antitumor effects of IDN5109 on head and neck squamous cell carcinoma. Oncol Rep. 2006 Feb;15(2):329-34.
94 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
95 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
96 Ascorbic acid enhances arsenic trioxide-induced cytotoxicity in multiple myeloma cells. Blood. 2001 Aug 1;98(3):805-13. doi: 10.1182/blood.v98.3.805.
97 Differential effect of anti-apoptotic genes Bcl-xL and c-FLIP on sensitivity of MCF-7 breast cancer cells to paclitaxel and docetaxel. Anticancer Res. 2005 May-Jun;25(3c):2367-79.
98 Sildenafil increases chemotherapeutic efficacy of doxorubicin in prostate cancer and ameliorates cardiac dysfunction. Proc Natl Acad Sci U S A. 2010 Oct 19;107(42):18202-7. doi: 10.1073/pnas.1006965107. Epub 2010 Sep 30.
99 ATR inhibitors VE-821 and VX-970 sensitize cancer cells to topoisomerase i inhibitors by disabling DNA replication initiation and fork elongation responses. Cancer Res. 2014 Dec 1;74(23):6968-79.
100 Predominant Bcl-XL knockdown disables antiapoptotic mechanisms: tumor necrosis factor-related apoptosis-inducing ligand-based triple chemotherapy overcomes chemoresistance in pancreatic cancer cells in vitro. Cancer Res. 2005 Mar 15;65(6):2344-52. doi: 10.1158/0008-5472.CAN-04-3502.
101 Anti-apoptotic proteins and catalase-dependent apoptosis resistance in nickel chloride-transformed human lung epithelial cells. Int J Oncol. 2013 Sep;43(3):936-46. doi: 10.3892/ijo.2013.2004. Epub 2013 Jul 3.
102 siRNA-mediated Bcl-2 and Bcl-xl gene silencing sensitizes human hepatoblastoma cells to chemotherapeutic drugs. Clin Exp Pharmacol Physiol. 2007 May-Jun;34(5-6):450-6. doi: 10.1111/j.1440-1681.2007.04593.x.