Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZRWTGA)

• DOT Name: Ras GTPase-activating-like protein IQGAP1 (IQGAP1)
• Synonyms: p195
• Gene Name: IQGAP1
• Related Disease:
  Glioma
  Lung adenocarcinoma
  Thyroid cancer
  Adult glioblastoma
  Advanced cancer
  Bladder cancer
  Brain cancer
  Brain neoplasm
  Breast cancer
  Breast carcinoma
  Carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Cardiovascular disease
  Chylomicron retention disease
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Endometrial carcinoma
  Esophageal squamous cell carcinoma
  Glioblastoma multiforme
  Hepatocellular carcinoma
  Liver cancer
  Multiple sclerosis
  Nasopharyngeal carcinoma
  Neoplasm
  Non-small-cell lung cancer
  Pancreatic ductal carcinoma
  Small lymphocytic lymphoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Diabetic kidney disease
  Epithelial ovarian cancer
  Metastatic malignant neoplasm
  Ovarian cancer
  Ovarian neoplasm
  Thyroid gland carcinoma
  Thyroid tumor
  Alopecia
  Gastric cancer
  Lung cancer
  Lung carcinoma
  Matthew-Wood syndrome
  Melanoma
  Pancreatic cancer
  Plasma cell myeloma
  Stomach cancer
  Thyroid gland papillary carcinoma
• UniProt ID: IQGA1_HUMAN
• PDB ID: 1X0H; 2RR8; 3FAY; 3I6X; 5L0O
• Pfam ID: PF00307 ; PF00612 ; PF00616 ; PF03836
• Sequence:
  MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGE
  DLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWL
  NAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEE
  EINNMKTELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDRRIPADTFAAL
  KNPNAMLVNLEEPLASTYQDILYQAKQDKMTNAKNRTENSERERDVYEELLTQAEIQGNI
  NKVNTFSALANIDLALEQGDALALFRALQSPALGLRGLQQQNSDWYLKQLLSDKQQKRQS
  GQTDPLQKEELQSGVDAANSAAQQYQRRLAAVALINAAIQKGVAEKTVLELMNPEAQLPQ
  VYPFAADLYQKELATLQRQSPEHNLTHPELSVAVEMLSSVALINRALESGDVNTVWKQLS
  SSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERIL
  AIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAV
  LWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPEC
  GETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQL
  SREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAIT
  CIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDII
  KIQAFIRANKARDDYKTLINAEDPPMVVVRKFVHLLDQSDQDFQEELDLMKMREEVITLI
  RSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKA
  LSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEY
  LLLRLFKTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIM
  DDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALAHEEVKTRLDSSIRNMRA
  VTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAI
  VAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQ
  KFRRFFQTACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEH
  NDPIHELLDDLGEVPTIESLIGESSGNLNDPNKEALAKTEVSLTLTNKFDVPGDENAEMD
  ARTILLNTKRLIVDVIRFQPGETLTEILETPATSEQEAEHQRAMQRRAIRDAKTPDKMKK
  SKSVKEDSNLTLQEKKEKIQTGLKKLTELGTVDPKNKYQELINDIARDIRNQRRYRQRRK
  AELVKLQQTYAALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKIS
  LKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQ
  DLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK
• Function: Plays a crucial role in regulating the dynamics and assembly of the actin cytoskeleton. Binds to activated CDC42 but does not stimulate its GTPase activity. It associates with calmodulin. Could serve as an assembly scaffold for the organization of a multimolecular complex that would interface incoming signals to the reorganization of the actin cytoskeleton at the plasma membrane. May promote neurite outgrowth. May play a possible role in cell cycle regulation by contributing to cell cycle progression after DNA replication arrest.
• Tissue Specificity: Expressed in the placenta, lung, and kidney . A lower level expression is seen in the heart, liver, skeletal muscle and pancreas .
• KEGG Pathway:
  Adherens junction (hsa04520)
  Regulation of actin cytoskeleton (hsa04810)
  Proteoglycans in cancer (hsa05205)
• Reactome Pathway:
  Glucagon-like Peptide-1 (GLP1) regulates insulin secretion (R-HSA-381676)
  RHO GTPases activate IQGAPs (R-HSA-5626467)
  MAP2K and MAPK activation (R-HSA-5674135)
  Neutrophil degranulation (R-HSA-6798695)
  Signaling by moderate kinase activity BRAF mutants (R-HSA-6802946)
  Signaling by high-kinase activity BRAF mutants (R-HSA-6802948)
  Signaling by BRAF and RAF1 fusions (R-HSA-6802952)
  Paradoxical activation of RAF signaling by kinase inactive BRAF (R-HSA-6802955)
  RHOA GTPase cycle (R-HSA-8980692)
  RHOC GTPase cycle (R-HSA-9013106)
  CDC42 GTPase cycle (R-HSA-9013148)
  RAC1 GTPase cycle (R-HSA-9013149)
  RAC2 GTPase cycle (R-HSA-9013404)
  RHOQ GTPase cycle (R-HSA-9013406)
  RHOU GTPase cycle (R-HSA-9013420)
  RHOV GTPase cycle (R-HSA-9013424)
  Signaling downstream of RAS mutants (R-HSA-9649948)
  Signaling by RAF1 mutants (R-HSA-9656223)
  Nephrin family interactions (R-HSA-373753)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Glioma	DIS5RPEH	Definitive	Biomarker	[1]
Lung adenocarcinoma	DISD51WR	Definitive	Biomarker	[2]
Thyroid cancer	DIS3VLDH	Definitive	Altered Expression	[3]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[6]
Brain cancer	DISBKFB7	Strong	Biomarker	[7]
Brain neoplasm	DISY3EKS	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[8]
Carcinoma	DISH9F1N	Strong	Genetic Variation	[9]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Biomarker	[10]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[11]
Chylomicron retention disease	DISOUTV5	Strong	Altered Expression	[12]
Colon cancer	DISVC52G	Strong	Biomarker	[13]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[13]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[14]
Endometrial carcinoma	DISXR5CY	Strong	Altered Expression	[15]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[16]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[4]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[17]
Liver cancer	DISDE4BI	Strong	Biomarker	[10]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[18]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Altered Expression	[19]
Neoplasm	DISZKGEW	Strong	Biomarker	[20]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[21]
Pancreatic ductal carcinoma	DIS26F9Q	Strong	Biomarker	[22]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[17]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[6]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[6]
Diabetic kidney disease	DISJMWEY	moderate	Biomarker	[23]
Epithelial ovarian cancer	DIS56MH2	moderate	Biomarker	[24]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[21]
Ovarian cancer	DISZJHAP	moderate	Biomarker	[24]
Ovarian neoplasm	DISEAFTY	moderate	Biomarker	[24]
Thyroid gland carcinoma	DISMNGZ0	Disputed	Altered Expression	[3]
Thyroid tumor	DISLVKMD	Disputed	Altered Expression	[3]
Alopecia	DIS37HU4	Limited	Genetic Variation	[25]
Gastric cancer	DISXGOUK	Limited	Biomarker	[26]
Lung cancer	DISCM4YA	Limited	Biomarker	[21]
Lung carcinoma	DISTR26C	Limited	Biomarker	[21]
Matthew-Wood syndrome	DISA7HR7	Limited	Biomarker	[22]
Melanoma	DIS1RRCY	Limited	Biomarker	[27]
Pancreatic cancer	DISJC981	Limited	Biomarker	[20]
Plasma cell myeloma	DIS0DFZ0	Limited	Altered Expression	[28]
Stomach cancer	DISKIJSX	Limited	Biomarker	[26]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Genetic Variation	[29]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitoxantrone	DMM39BF	Approved	Ras GTPase-activating-like protein IQGAP1 (IQGAP1) affects the response to substance of Mitoxantrone.	[52]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[30]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[31]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[32]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[33]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[34]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[35]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[36]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[37]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[38]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[33]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[39]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[40]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[38]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[43]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene decreases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[45]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[46]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[48]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[49]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[51]

2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin affects the binding of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[41]
DNCB	DMDTVYC	Phase 2	DNCB affects the binding of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[44]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Crizotinib	DM4F29C	Approved	Crizotinib decreases the phosphorylation of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[42]
Afatinib	DMTKD7Q	Approved	Afatinib decreases the phosphorylation of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[42]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Ras GTPase-activating-like protein IQGAP1 (IQGAP1).	[50]

References

• [1] IQGAP1siRNA inhibits proliferation and metastasis of U251 and U373 glioma cell lines.Mol Med Rep. 2017 Apr;15(4):2074-2082. doi: 10.3892/mmr.2017.6257. Epub 2017 Feb 28.
• [2] Expression pattern of the scaffold protein IQGAP1 in lung cancer.Oncol Rep. 2005 Mar;13(3):427-31.
• [3] Knockdown of IQGAP1 inhibits proliferation and epithelial-mesenchymal transition by Wnt/-catenin pathway in thyroid cancer.Onco Targets Ther. 2017 Mar 13;10:1549-1559. doi: 10.2147/OTT.S128564. eCollection 2017.
• [4] IQGAP1, AmotL2, and FKBP51 Scaffoldins in the Glioblastoma Microenvironment.J Histochem Cytochem. 2019 Jul;67(7):481-494. doi: 10.1369/0022155419833334. Epub 2019 Feb 22.
• [5] A PI3K/AKT Scaffolding Protein, IQ Motif-Containing GTPase Associating Protein 1 (IQGAP1), Promotes Head and Neck Carcinogenesis.Clin Cancer Res. 2020 Jan 1;26(1):301-311. doi: 10.1158/1078-0432.CCR-19-1063. Epub 2019 Oct 9.
• [6] Patient Mutation Directed shRNA Screen Uncovers Novel Bladder Tumor Growth Suppressors.Mol Cancer Res. 2015 Sep;13(9):1306-15. doi: 10.1158/1541-7786.MCR-15-0130. Epub 2015 Jun 15.
• [7] A novel brain tumour model in zebrafish reveals the role of YAP activation in MAPK- and PI3K-induced malignant growth.Dis Model Mech. 2017 Jan 1;10(1):15-28. doi: 10.1242/dmm.026500. Epub 2016 Nov 24.
• [8] Ras GTPase-Activating-Like Protein IQGAP1 (IQGAP1) Promotes Breast Cancer Proliferation and Invasion and Correlates with Poor Clinical Outcomes.Med Sci Monit. 2018 May 20;24:3315-3323. doi: 10.12659/MSM.909916.
• [9] Nucleotide variants within the IQGAP1 gene in diffuse-type gastric cancers.Genes Chromosomes Cancer. 2005 Mar;42(3):280-6. doi: 10.1002/gcc.20150.
• [10] IQGAP1 and IQGAP2 are reciprocally altered in hepatocellular carcinoma.BMC Gastroenterol. 2010 Oct 26;10:125. doi: 10.1186/1471-230X-10-125.
• [11] Novel Pathological Role of hnRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1) in Vascular Smooth Muscle Cell Function and Neointima Hyperplasia.Arterioscler Thromb Vasc Biol. 2017 Nov;37(11):2182-2194. doi: 10.1161/ATVBAHA.117.310020. Epub 2017 Sep 14.
• [12] Molecular analysis and intestinal expression of SAR1 genes and proteins in Anderson's disease (Chylomicron retention disease). Orphanet J Rare Dis. 2011 Jan 14;6:1. doi: 10.1186/1750-1172-6-1.
• [13] Overexpression of IQGAP1 in advanced colorectal cancer correlates with poor prognosis-critical role in tumor invasion.Int J Cancer. 2010 Jun 1;126(11):2563-74. doi: 10.1002/ijc.24987.
• [14] miR?24 inhibits cell growth through targeting IQGAP1 in colorectal cancer.Mol Med Rep. 2018 Dec;18(6):5270-5278. doi: 10.3892/mmr.2018.9518. Epub 2018 Sep 27.
• [15] Reactivation of epigenetically silenced miR-124 reverses the epithelial-to-mesenchymal transition and inhibits invasion in endometrial cancer cells via the direct repression of IQGAP1 expression.Oncotarget. 2016 Apr 12;7(15):20260-70. doi: 10.18632/oncotarget.7754.
• [16] Overexpression of IQGAP1 promotes the angiogenesis of esophageal squamous cell carcinoma through the AKT and ERKmediated VEGFVEGFR2 signaling pathway.Oncol Rep. 2018 Sep;40(3):1795-1802. doi: 10.3892/or.2018.6558. Epub 2018 Jul 11.
• [17] IQGAP1 gene silencing induces apoptosis and decreases the invasive capacity of human hepatocellular carcinoma cells.Tumour Biol. 2016 Oct;37(10):13927-13939. doi: 10.1007/s13277-016-5283-8. Epub 2016 Aug 3.
• [18] Allelic imbalance of multiple sclerosis susceptibility genes IKZF3 and IQGAP1 in human peripheral blood.BMC Genet. 2016 Apr 14;17:59. doi: 10.1186/s12863-016-0367-4.
• [19] MTA1 promotes viability and motility in nasopharyngeal carcinoma by modulating IQGAP1 expression.J Cell Biochem. 2018 May;119(5):3864-3872. doi: 10.1002/jcb.26494. Epub 2018 Jan 22.
• [20] IQGAP1 promotes pancreatic cancer progression and epithelial-mesenchymal transition (EMT) through Wnt/-catenin signaling.Sci Rep. 2019 May 17;9(1):7539. doi: 10.1038/s41598-019-44048-y.
• [21] MAP4K3/GLK Promotes Lung Cancer Metastasis by Phosphorylating and Activating IQGAP1.Cancer Res. 2019 Oct 1;79(19):4978-4993. doi: 10.1158/0008-5472.CAN-19-1402. Epub 2019 Aug 20.
• [22] IQGAP1 Maintains Pancreatic Ductal Adenocarcinoma Clonogenic Growth and Metastasis.Pancreas. 2019 Jan;48(1):94-98. doi: 10.1097/MPA.0000000000001198.
• [23] IQGAP1 mediates podocyte injury in diabetic kidney disease by regulating nephrin endocytosis.Cell Signal. 2019 Jul;59:13-23. doi: 10.1016/j.cellsig.2019.03.009. Epub 2019 Mar 9.
• [24] Silencing of IQGAP1 by shRNA inhibits the invasion of ovarian carcinoma HO-8910PM cells in vitro.J Exp Clin Cancer Res. 2008 Nov 27;27(1):77. doi: 10.1186/1756-9966-27-77.
• [25] Genetic prediction of male pattern baldness.PLoS Genet. 2017 Feb 14;13(2):e1006594. doi: 10.1371/journal.pgen.1006594. eCollection 2017 Feb.
• [26] Asparaginyl endopeptidase improves the resistance of microtubule-targeting drugs in gastric cancer through IQGAP1 modulating the EGFR/JNK/ERK signaling pathway.Onco Targets Ther. 2017 Feb 3;10:627-643. doi: 10.2147/OTT.S125579. eCollection 2017.
• [27] The lincRNA MIRAT binds to IQGAP1 and modulates the MAPK pathway in NRAS mutant melanoma.Sci Rep. 2018 Jul 19;8(1):10902. doi: 10.1038/s41598-018-27643-3.
• [28] Quercetin suppresses the proliferation of multiple myeloma cells by down-regulating IQ motif-containing GTPase activating protein 1 expression and extracellular signal-regulated kinase activation.Leuk Lymphoma. 2014 Nov;55(11):2597-604. doi: 10.3109/10428194.2013.879128. Epub 2014 Mar 7.
• [29] IQGAP1 plays an important role in the invasiveness of thyroid cancer.Clin Cancer Res. 2010 Dec 15;16(24):6009-18. doi: 10.1158/1078-0432.CCR-10-1627. Epub 2010 Oct 19.
• [30] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [31] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [32] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [33] Comparative gene expression profiling reveals partially overlapping but distinct genomic actions of different antiestrogens in human breast cancer cells. J Cell Biochem. 2006 Aug 1;98(5):1163-84.
• [34] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [35] Quantitative proteomic analysis of HepG2 cells treated with quercetin suggests IQGAP1 involved in quercetin-induced regulation of cell proliferation and migration. OMICS. 2009 Apr;13(2):93-103. doi: 10.1089/omi.2008.0075.
• [36] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [37] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [38] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [39] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [40] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [41] Untargeted Proteomics and Systems-Based Mechanistic Investigation of Artesunate in Human Bronchial Epithelial Cells. Chem Res Toxicol. 2015 Oct 19;28(10):1903-13. doi: 10.1021/acs.chemrestox.5b00105. Epub 2015 Sep 21.
• [42] Tyrosine phosphorylation of the scaffold protein IQGAP1 in the MET pathway alters function. J Biol Chem. 2020 Dec 25;295(52):18105-18121. doi: 10.1074/jbc.RA120.015891. Epub 2020 Oct 21.
• [43] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [44] Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
• [45] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [46] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [47] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [48] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [49] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [50] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [51] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [52] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.