Details of the Drug

General Information of Drug (ID: DMRJ3YX)

Drug Name

Alteplase

Synonyms

Activase (TN)

Indication

Disease Entry	ICD 11	Status	REF
Acute myocardial infarction	BA41	Approved	[1]
Pulmonary embolism	BB00	Approved	[2]
------------------------------------------------------------------------------------

Therapeutic Class

Thrombolytic Agents

Sequence

SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGG
TCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSA
LAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDC
YFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAK
PWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRS
PGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVH
KEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEAL
SPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGG
PLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP

Cross-matching ID

DrugBank ID: DB00009
TTD ID: D07BQE

Repurposed Drugs (RPD)

Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Plasminogen (PLG)	TTP86E2	PLMN_HUMAN	Activator	[3]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease

Acute myocardial infarction

ICD Disease Classification

BA41

Molecule Name	Molecule Type	Gene Name	p-value	Fold-Change	Z-score
Plasminogen (PLG)	DTT	PLG	8.61E-01	-0.01	-0.09

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Alteplase (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Drotrecogin alfa	DM59JCN	Major	Increased risk of bleeding by the combination of Alteplase and Drotrecogin alfa.	Cerebral ischaemia [8B1Z]	[4]
Pentosan polysulfate	DM2HRKE	Moderate	Increased risk of bleeding by the combination of Alteplase and Pentosan polysulfate.	Chronic pain [MG30]	[5]
Phenylbutazone	DMAYL0T	Moderate	Increased risk of bleeding by the combination of Alteplase and Phenylbutazone.	Chronic pain [MG30]	[6]
Ketoprofen	DMRKXPT	Moderate	Increased risk of bleeding by the combination of Alteplase and Ketoprofen.	Chronic pain [MG30]	[6]
Levomilnacipran	DMV26S8	Moderate	Increased risk of bleeding by the combination of Alteplase and Levomilnacipran.	Chronic pain [MG30]	[7]
Anisindione	DM2C48U	Major	Increased risk of bleeding by the combination of Alteplase and Anisindione.	Coagulation defect [3B10]	[8]
Regorafenib	DMHSY1I	Major	Increased risk of bleeding by the combination of Alteplase and Regorafenib.	Colorectal cancer [2B91]	[9]
Intedanib	DMSTA36	Moderate	Increased risk of bleeding by the combination of Alteplase and Intedanib.	Colorectal cancer [2B91]	[10]
Ardeparin	DMYRX8B	Major	Increased risk of bleeding by the combination of Alteplase and Ardeparin.	Coronary thrombosis [BA43]	[11]
Danaparoid	DM6CLBN	Major	Increased risk of bleeding by the combination of Alteplase and Danaparoid.	Deep vein thrombosis [BD71]	[11]
Rivaroxaban	DMQMBZ1	Major	Increased risk of bleeding by the combination of Alteplase and Rivaroxaban.	Deep vein thrombosis [BD71]	[12]
Sertraline	DM0FB1J	Moderate	Increased risk of bleeding by the combination of Alteplase and Sertraline.	Depression [6A70-6A7Z]	[7]
Fluoxetine	DM3PD2C	Moderate	Increased risk of bleeding by the combination of Alteplase and Fluoxetine.	Depression [6A70-6A7Z]	[7]
Vilazodone	DM4LECQ	Moderate	Increased risk of bleeding by the combination of Alteplase and Vilazodone.	Depression [6A70-6A7Z]	[7]
Paroxetine	DM5PVQE	Moderate	Increased risk of bleeding by the combination of Alteplase and Paroxetine.	Depression [6A70-6A7Z]	[7]
Vortioxetine	DM6F1PU	Moderate	Increased risk of bleeding by the combination of Alteplase and Vortioxetine.	Depression [6A70-6A7Z]	[7]
Duloxetine	DM9BI7M	Moderate	Increased risk of bleeding by the combination of Alteplase and Duloxetine.	Depression [6A70-6A7Z]	[7]
Milnacipran	DMBFE74	Moderate	Increased risk of bleeding by the combination of Alteplase and Milnacipran.	Depression [6A70-6A7Z]	[7]
Escitalopram	DMFK9HG	Moderate	Increased risk of bleeding by the combination of Alteplase and Escitalopram.	Depression [6A70-6A7Z]	[7]
Desvenlafaxine	DMHD4PE	Moderate	Increased risk of bleeding by the combination of Alteplase and Desvenlafaxine.	Depression [6A70-6A7Z]	[7]
Clomipramine	DMINRKW	Moderate	Increased risk of bleeding by the combination of Alteplase and Clomipramine.	Depression [6A70-6A7Z]	[7]
Fluvoxamine	DMQTJSX	Moderate	Increased risk of bleeding by the combination of Alteplase and Fluvoxamine.	Depression [6A70-6A7Z]	[7]
Venlafaxine	DMR6QH0	Moderate	Increased risk of bleeding by the combination of Alteplase and Venlafaxine.	Depression [6A70-6A7Z]	[7]
Heme	DMGC287	Moderate	Increased risk of bleeding by the combination of Alteplase and Heme.	Discovery agent [N.A.]	[13]
Apigenin	DMI3491	Minor	Increased risk of bleeding by the combination of Alteplase and Apigenin.	Discovery agent [N.A.]	[14]
Citalopram derivative 1	DMITX1G	Moderate	Increased risk of bleeding by the combination of Alteplase and Citalopram derivative 1.	Discovery agent [N.A.]	[7]
PMID28870136-Compound-49	DMTUC9E	Moderate	Increased risk of bleeding by the combination of Alteplase and PMID28870136-Compound-49.	Discovery agent [N.A.]	[15]
Fenfluramine	DM0762O	Moderate	Increased risk of bleeding by the combination of Alteplase and Fenfluramine.	Epilepsy/seizure [8A61-8A6Z]	[7]
Suprofen	DMKXJZ7	Moderate	Increased risk of bleeding by the combination of Alteplase and Suprofen.	Eye anterior segment structural developmental anomaly [LA11]	[6]
Mefenamic acid	DMK7HFI	Moderate	Increased risk of bleeding by the combination of Alteplase and Mefenamic acid.	Female pelvic pain [GA34]	[6]
Avapritinib	DMK2GZX	Major	Increased risk of bleeding by the combination of Alteplase and Avapritinib.	Gastrointestinal stromal tumour [2B5B]	[9]
Sulfinpyrazone	DMEV954	Moderate	Increased risk of bleeding by the combination of Alteplase and Sulfinpyrazone.	Gout [FA25]	[16]
Ramipril	DM2R68E	Moderate	Increased risk of angioedema by the combination of Alteplase and Ramipril.	Heart failure [BD10-BD1Z]	[17]
Tipranavir	DM8HJX6	Major	Increased risk of bleeding by the combination of Alteplase and Tipranavir.	Human immunodeficiency virus disease [1C60-1C62]	[18]
Moexipril	DM26E4B	Moderate	Increased risk of angioedema by the combination of Alteplase and Moexipril.	Hypertension [BA00-BA04]	[17]
Captopril	DM458UM	Moderate	Increased risk of angioedema by the combination of Alteplase and Captopril.	Hypertension [BA00-BA04]	[17]
Trandolapril	DM4L6EU	Moderate	Increased risk of angioedema by the combination of Alteplase and Trandolapril.	Hypertension [BA00-BA04]	[17]
Fosinopril	DM9NJ52	Moderate	Increased risk of angioedema by the combination of Alteplase and Fosinopril.	Hypertension [BA00-BA04]	[17]
Enalapril	DMNFUZR	Moderate	Increased risk of angioedema by the combination of Alteplase and Enalapril.	Hypertension [BA00-BA04]	[17]
Perindopril	DMOPZDT	Moderate	Increased risk of angioedema by the combination of Alteplase and Perindopril.	Hypertension [BA00-BA04]	[17]
Quinapril	DMR8H31	Moderate	Increased risk of angioedema by the combination of Alteplase and Quinapril.	Hypertension [BA00-BA04]	[17]
Lisinopril	DMUOK4C	Moderate	Increased risk of angioedema by the combination of Alteplase and Lisinopril.	Hypertension [BA00-BA04]	[17]
Dipyridamole	DMXY30O	Moderate	Increased risk of bleeding by the combination of Alteplase and Dipyridamole.	Hypertension [BA00-BA04]	[16]
Meclofenamic acid	DM05FXR	Moderate	Increased risk of bleeding by the combination of Alteplase and Meclofenamic acid.	Inflammatory spondyloarthritis [FA92]	[6]
Ticlopidine	DMO946V	Moderate	Increased risk of bleeding by the combination of Alteplase and Ticlopidine.	Ischaemic/haemorrhagic stroke [8B20]	[16]
Tositumomab	DMMYZ3D	Major	Increased risk of bleeding by the combination of Alteplase and Tositumomab.	Malignant haematopoietic neoplasm [2B33]	[19]
Acalabrutinib	DM7GCVW	Major	Increased risk of bleeding by the combination of Alteplase and Acalabrutinib.	Mature B-cell lymphoma [2A85]	[20]
Ibrutinib	DMHZCPO	Major	Increased risk of bleeding by the combination of Alteplase and Ibrutinib.	Mature B-cell lymphoma [2A85]	[21]
Ponatinib	DMYGJQO	Major	Increased risk of bleeding by the combination of Alteplase and Ponatinib.	Mature B-cell lymphoma [2A85]	[22]
Panobinostat	DM58WKG	Major	Increased risk of bleeding by the combination of Alteplase and Panobinostat.	Multiple myeloma [2A83]	[17]
Dasatinib	DMJV2EK	Major	Increased risk of bleeding by the combination of Alteplase and Dasatinib.	Myeloproliferative neoplasm [2A20]	[23]
Omacetaxine mepesuccinate	DMPU2WX	Major	Increased risk of bleeding by the combination of Alteplase and Omacetaxine mepesuccinate.	Myeloproliferative neoplasm [2A20]	[5]
Prasugrel	DM7MT6E	Major	Increased risk of bleeding by the combination of Alteplase and Prasugrel.	Myocardial infarction [BA41-BA43]	[9]
Vorapaxar	DMA16BR	Major	Increased risk of bleeding by the combination of Alteplase and Vorapaxar.	Myocardial infarction [BA41-BA43]	[24]
Sibutramine	DMFJTDI	Moderate	Increased risk of bleeding by the combination of Alteplase and Sibutramine.	Obesity [5B80-5B81]	[7]
Dexfenfluramine	DMJ7YDS	Moderate	Increased risk of bleeding by the combination of Alteplase and Dexfenfluramine.	Obesity [5B80-5B81]	[7]
Diclofenac	DMPIHLS	Moderate	Increased risk of bleeding by the combination of Alteplase and Diclofenac.	Osteoarthritis [FA00-FA05]	[6]
Nepafenac	DMYK490	Moderate	Increased risk of bleeding by the combination of Alteplase and Nepafenac.	Osteoarthritis [FA00-FA05]	[6]
Naproxen	DMZ5RGV	Moderate	Increased risk of bleeding by the combination of Alteplase and Naproxen.	Osteoarthritis [FA00-FA05]	[6]
MK-4827	DMLYGH4	Moderate	Increased risk of bleeding by the combination of Alteplase and MK-4827.	Ovarian cancer [2C73]	[9]
Aspirin	DM672AH	Moderate	Increased risk of bleeding by the combination of Alteplase and Aspirin.	Pain [MG30-MG3Z]	[16]
Etodolac	DM6WJO9	Moderate	Increased risk of bleeding by the combination of Alteplase and Etodolac.	Pain [MG30-MG3Z]	[6]
Diflunisal	DM7EN8I	Moderate	Increased risk of bleeding by the combination of Alteplase and Diflunisal.	Pain [MG30-MG3Z]	[16]
Ibuprofen	DM8VCBE	Moderate	Increased risk of bleeding by the combination of Alteplase and Ibuprofen.	Pain [MG30-MG3Z]	[6]
Nabumetone	DMAT2XH	Moderate	Increased risk of bleeding by the combination of Alteplase and Nabumetone.	Pain [MG30-MG3Z]	[6]
Piroxicam	DMTK234	Moderate	Increased risk of bleeding by the combination of Alteplase and Piroxicam.	Pain [MG30-MG3Z]	[6]
Choline salicylate	DM8P137	Moderate	Increased risk of bleeding by the combination of Alteplase and Choline salicylate.	Postoperative inflammation [1A00-CA43]	[16]
Ketorolac	DMI4EL5	Moderate	Increased risk of bleeding by the combination of Alteplase and Ketorolac.	Postoperative inflammation [1A00-CA43]	[6]
Bromfenac	DMKB79O	Moderate	Increased risk of bleeding by the combination of Alteplase and Bromfenac.	Postoperative inflammation [1A00-CA43]	[6]
Treprostinil	DMTIQF3	Moderate	Increased risk of bleeding by the combination of Alteplase and Treprostinil.	Pulmonary hypertension [BB01]	[16]
Epoprostenol	DMUTYR2	Moderate	Increased risk of bleeding by the combination of Alteplase and Epoprostenol.	Pulmonary hypertension [BB01]	[16]
Iloprost	DMVPZBE	Moderate	Increased risk of bleeding by the combination of Alteplase and Iloprost.	Pulmonary hypertension [BB01]	[16]
Salsalate	DM13P4C	Moderate	Increased risk of bleeding by the combination of Alteplase and Salsalate.	Rheumatoid arthritis [FA20]	[16]
Meloxicam	DM2AR7L	Moderate	Increased risk of bleeding by the combination of Alteplase and Meloxicam.	Rheumatoid arthritis [FA20]	[6]
Sulindac	DM2QHZU	Moderate	Increased risk of bleeding by the combination of Alteplase and Sulindac.	Rheumatoid arthritis [FA20]	[6]
Oxaprozin	DM9UB0P	Moderate	Increased risk of bleeding by the combination of Alteplase and Oxaprozin.	Rheumatoid arthritis [FA20]	[6]
Flurbiprofen	DMGN4BY	Moderate	Increased risk of bleeding by the combination of Alteplase and Flurbiprofen.	Rheumatoid arthritis [FA20]	[6]
Fenoprofen	DML5VQ0	Moderate	Increased risk of bleeding by the combination of Alteplase and Fenoprofen.	Rheumatoid arthritis [FA20]	[6]
Indomethacin	DMSC4A7	Moderate	Increased risk of bleeding by the combination of Alteplase and Indomethacin.	Rheumatoid arthritis [FA20]	[6]
Tolmetin	DMWUIJE	Moderate	Increased risk of bleeding by the combination of Alteplase and Tolmetin.	Rheumatoid arthritis [FA20]	[6]
Salicyclic acid	DM2F8XZ	Moderate	Increased risk of bleeding by the combination of Alteplase and Salicyclic acid.	Seborrhoeic dermatitis [EA81]	[16]
Curcumin	DMQPH29	Minor	Increased risk of bleeding by the combination of Alteplase and Curcumin.	Solid tumour/cancer [2A00-2F9Z]	[25]
Warfarin	DMJYCVW	Major	Increased risk of bleeding by the combination of Alteplase and Warfarin.	Supraventricular tachyarrhythmia [BC81]	[8]
Caplacizumab	DMPUKA7	Major	Increased risk of bleeding by the combination of Alteplase and Caplacizumab.	Thrombocytopenia [3B64]	[17]
Apixaban	DM89JLN	Major	Increased risk of bleeding by the combination of Alteplase and Apixaban.	Thrombosis [DB61-GB90]	[9]
Cangrelor	DM8JRH0	Major	Increased risk of bleeding by the combination of Alteplase and Cangrelor.	Thrombosis [DB61-GB90]	[9]
Brilinta	DMBR01X	Moderate	Increased risk of bleeding by the combination of Alteplase and Brilinta.	Thrombosis [DB61-GB90]	[9]
Argatroban	DMFI46A	Major	Increased risk of bleeding by the combination of Alteplase and Argatroban.	Thrombosis [DB61-GB90]	[26]
Dicumarol	DMFQCB1	Major	Increased risk of bleeding by the combination of Alteplase and Dicumarol.	Thrombosis [DB61-GB90]	[8]
Clopidogrel	DMOL54H	Moderate	Increased risk of bleeding by the combination of Alteplase and Clopidogrel.	Thrombosis [DB61-GB90]	[16]
Cabozantinib	DMIYDT4	Major	Increased risk of bleeding by the combination of Alteplase and Cabozantinib.	Thyroid cancer [2D10]	[27]
Betrixaban	DM2C4RF	Major	Increased risk of bleeding by the combination of Alteplase and Betrixaban.	Venous thromboembolism [BD72]	[28]
-----------


⏷ Show the Full List of 92 DDI Information of This Drug

References

1	Single-bolus tenecteplase compared with front-loaded alteplase in acute myocardial infarction: the ASSENT-2 double-blind randomised trial. Lancet. 1999 Aug 28;354(9180):716-22.
2	Emerging drugs in peripheral arterial disease. Expert Opin Emerg Drugs. 2006 Mar;11(1):75-90.
3	Thrombolytic therapies: the current state of affairs. J Endovasc Ther. 2005 Apr;12(2):224-32.
4	Product Information. Xigris (drotrecogin alfa). Lilly, Eli and Company, Indianapolis, IN.
5	Product Information. Brukinsa (zanubrutinib). BeiGene USA, Inc, San Mateo, CA.
6	Product Information. Acular (ketorolac). Allergan Inc, Irvine, CA.
7	Alderman CP, Moritz CK, Ben-Tovim DI "Abnormal platelet aggregation associated with fluoxetine therapy." Ann Pharmacother 26 (1992): 1517-9. [PMID: 1482806]
8	Arora RR, Magun AM, Grossman M, Katz J "Cholesterol embolization syndrome after intravenous tissue plasminogen activator for acute myocardial infarction." Am Heart J 126 (1993): 225-8. [PMID: 8322670]
9	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
10	Product Information. Ofev (nintedanib). Boehringer Ingelheim, Ridgefield, CT.
11	Price AJ, Frcpath DO "Is there a clinical interaction between low molecular weight heparin and non-steroidal analgesics after total hip replacement?" Ann R Coll Surg Engl 77 (1995): 395. [PMID: 7486773]
12	Product Information. Xarelto (rivaroxaban). Bayer Inc, Toronto, IA.
13	Product Information. Panhematin (hemin). Recordati Rare Diseases Inc, Lebanon, NJ.
14	Heck AM, DeWitt BA, Lukes AL "Potential interactions between alternative therapies and warfarin." Am J Health Syst Pharm 57 (2000): 1221-7 quiz 1228-30. [PMID: 10902065]
15	Canadian Pharmacists Association.
16	Harder S, Klinkhardt U "Thrombolytics: drug interactions of clinical significance." Drug Saf 23 (2000): 391-9. [PMID: 11085346]
17	Cerner Multum, Inc. "Australian Product Information.".
18	Product Information. Aptivus (tipranavir). Boehringer-Ingelheim, Ridgefield, CT.
19	Product Information. Bexxar I 131 Therapeutic (iodine I 131 tositumomab). GlaxoSmithKline, Research Triangle Park, NC.
20	Product Information. Calquence (acalabrutinib). Astra-Zeneca Pharmaceuticals, Wilmington, DE.
21	Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
22	Product Information. Iclusig (ponatinib). Ariad Pharmaceuticals Inc, Cambridge, MA.
23	Product Information. Sprycel (dasatinib). Bristol-Myers Squibb, Princeton, NJ.
24	Product Information. Zontivity (vorapaxar). Merck & Company Inc, Whitehouse Station, NJ.
25	Abebe W "Herbal medication: potential for adverse interactions with analgesic drugs." J Clin Pharm Ther 27 (2002): 391-401. [PMID: 12472978]
26	Product Information. Acova (argatroban) SmithKline Beecham, Philadelphia, PA.
27	Product Information. Cometriq (cabozantinib). Exelixis Inc, S San Francisco, CA.
28	Product Information. Bevyxxa (betrixaban). Portola Pharmaceuticals, South San Francisco, CA.