Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3SQMLU)

• DOT Name: Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B)
• Synonyms: Acidic protein rich in leucines; Putative HLA-DR-associated protein I-2; PHAPI2; Silver-stainable protein SSP29
• Gene Name: ANP32B
• Related Disease:
  Arthritis
  B-cell lymphoma
  Acute lymphocytic leukaemia
  Adenocarcinoma
  Adult glioblastoma
  Adult lymphoma
  Advanced cancer
  Anca-associated vasculitis
  Atopic dermatitis
  Autoimmune disease
  B-cell neoplasm
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Classic Hodgkin lymphoma
  Clear cell renal carcinoma
  Colon carcinoma
  Colorectal carcinoma
  Gastric cancer
  Glioblastoma multiforme
  Hepatocellular carcinoma
  IgA nephropathy
  Latent tuberculosis infection
  leukaemia
  Leukemia
  Lung carcinoma
  Lupus
  Lymphoma
  Multiple sclerosis
  Neoplasm
  Nephropathy
  Non-small-cell lung cancer
  Osteoarthritis
  Pediatric lymphoma
  Periodontitis
  Plasma cell myeloma
  Renal cell carcinoma
  Rheumatoid arthritis
  Squamous cell carcinoma
  Stomach cancer
  Tuberculosis
  Acute myelogenous leukaemia
  Small lymphocytic lymphoma
  Coronary atherosclerosis
  Coronary heart disease
  Lupus nephritis
  Myocardial infarction
  Pancreatic cancer
  Systemic lupus erythematosus
• UniProt ID: AN32B_HUMAN
• PDB ID: 2ELL; 2RR6
• Pfam ID: PF14580
• Sequence:
  MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNL
  PKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDL
  FNCEVTNLNDYRESVFKLLPQLTYLDGYDREDQEAPDSDAEVDGVDEEEEDEEGEDEEDE
  DDEDGEEEEFDEEDDEDEDVEGDEDDDEVSEEEEEFGLDEEDEDEDEDEEEEEGGKGEKR
  KRETDDEGEDD
• Function: Multifunctional protein that is involved in the regulation of many processes including cell proliferation, apoptosis, cell cycle progression or transcription. Regulates the proliferation of neuronal stem cells, differentiation of leukemic cells and progression from G1 to S phase of the cell cycle. As negative regulator of caspase-3-dependent apoptosis, may act as an antagonist of ANP32A in regulating tissue homeostasis. Exhibits histone chaperone properties, able to recruit histones to certain promoters, thus regulating the transcription of specific genes. Also plays an essential role in the nucleocytoplasmic transport of specific mRNAs via the uncommon nuclear mRNA export receptor XPO1/CRM1. Participates in the regulation of adequate adaptive immune responses by acting on mRNA expression and cell proliferation; (Microbial infection) Plays an essential role in influenza A and B viral genome replication. Also plays a role in foamy virus mRNA export from the nucleus to the cytoplasm.
• Tissue Specificity: Expressed in heart, lung, pancreas, prostate and in spleen, thymus and placenta.

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Arthritis	DIST1YEL	Definitive	Biomarker	[1]
B-cell lymphoma	DISIH1YQ	Definitive	Biomarker	[2]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[3]
Adenocarcinoma	DIS3IHTY	Strong	Genetic Variation	[4]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[5]
Adult lymphoma	DISK8IZR	Strong	Biomarker	[6]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Anca-associated vasculitis	DISU3CNU	Strong	Altered Expression	[7]
Atopic dermatitis	DISTCP41	Strong	Altered Expression	[8]
Autoimmune disease	DISORMTM	Strong	Biomarker	[9]
B-cell neoplasm	DISVY326	Strong	Biomarker	[10]
Breast cancer	DIS7DPX1	Strong	Biomarker	[11]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[11]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[12]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Altered Expression	[13]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[14]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[15]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[16]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[17]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[18]
IgA nephropathy	DISZ8MTK	Strong	Altered Expression	[19]
Latent tuberculosis infection	DIS6R1EH	Strong	Altered Expression	[20]
leukaemia	DISS7D1V	Strong	Biomarker	[21]
Leukemia	DISNAKFL	Strong	Biomarker	[21]
Lung carcinoma	DISTR26C	Strong	Biomarker	[22]
Lupus	DISOKJWA	Strong	Biomarker	[23]
Lymphoma	DISN6V4S	Strong	Biomarker	[6]
Multiple sclerosis	DISB2WZI	Strong	Altered Expression	[24]
Neoplasm	DISZKGEW	Strong	Biomarker	[2]
Nephropathy	DISXWP4P	Strong	Biomarker	[25]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[26]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[27]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[6]
Periodontitis	DISI9JOI	Strong	Biomarker	[28]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[29]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[14]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[30]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[31]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[17]
Tuberculosis	DIS2YIMD	Strong	Altered Expression	[20]
Acute myelogenous leukaemia	DISCSPTN	moderate	Altered Expression	[32]
Small lymphocytic lymphoma	DIS30POX	moderate	Altered Expression	[33]
Coronary atherosclerosis	DISKNDYU	Limited	Altered Expression	[34]
Coronary heart disease	DIS5OIP1	Limited	Altered Expression	[34]
Lupus nephritis	DISCVGPZ	Limited	Biomarker	[35]
Myocardial infarction	DIS655KI	Limited	Biomarker	[34]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[36]
Systemic lupus erythematosus	DISI1SZ7	Limited	Biomarker	[37]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[38]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[39]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[40]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[41]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[42]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[43]
Marinol	DM70IK5	Approved	Marinol increases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[44]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[45]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[46]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[47]
Aminoglutethimide	DMWFHMZ	Approved	Aminoglutethimide decreases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[48]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[49]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[50]
UNC0379	DMD1E4J	Preclinical	UNC0379 decreases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[51]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[52]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[53]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B).	[54]

References

• [1] Therapeutic effects of a novel BAFF blocker on arthritis.Signal Transduct Target Ther. 2019 Jun 14;4:19. doi: 10.1038/s41392-019-0051-z. eCollection 2019.
• [2] CXCL-8/IL8 Produced by Diffuse Large B-cell Lymphomas Recruits Neutrophils Expressing a Proliferation-Inducing Ligand APRIL.Cancer Res. 2017 Mar 1;77(5):1097-1107. doi: 10.1158/0008-5472.CAN-16-0786. Epub 2016 Dec 6.
• [3] APRIL is Involved in the Proliferation and Metastasis of Acute Lymphoblastic Leukemia Cells.J Pediatr Hematol Oncol. 2018 Nov;40(8):588-593. doi: 10.1097/MPH.0000000000001198.
• [4] Targeted Proteomics for Multiplexed Verification of Markers of Colorectal Tumorigenesis.Mol Cell Proteomics. 2017 Mar;16(3):407-427. doi: 10.1074/mcp.M116.062273. Epub 2017 Jan 4.
• [5] Abnormal production of the TNF-homologue APRIL increases the proliferation of human malignant glioblastoma cell lines via a specific receptor.Oncogene. 2004 Apr 15;23(17):3005-12. doi: 10.1038/sj.onc.1207350.
• [6] Systemic lupus erythematosus and lymphoma: Incidence, pathogenesis and biology.Leuk Res. 2018 Dec;75:45-49. doi: 10.1016/j.leukres.2018.11.004. Epub 2018 Nov 12.
• [7] Plasma cells within granulomatous inflammation display signs pointing to autoreactivity and destruction in granulomatosis with polyangiitis.Arthritis Res Ther. 2014 Feb 20;16(1):R55. doi: 10.1186/ar4490.
• [8] The expression of BAFF, APRIL and TWEAK is altered in eczema skin but not in the circulation of atopic and seborrheic eczema patients.PLoS One. 2011;6(7):e22202. doi: 10.1371/journal.pone.0022202. Epub 2011 Jul 13.
• [9] The acidic protein rich in leucines Anp32b is an immunomodulator of inflammation in mice.Sci Rep. 2019 Mar 19;9(1):4853. doi: 10.1038/s41598-019-41269-z.
• [10] A capture-sequencing strategy identifies IRF8, EBF1, and APRIL as novel IGH fusion partners in B-cell lymphoma.Blood. 2013 Aug 1;122(5):726-33. doi: 10.1182/blood-2013-04-495804. Epub 2013 Jun 17.
• [11] BCMA (TNFRSF17) Induces APRIL and BAFF Mediated Breast Cancer Cell Stemness.Front Oncol. 2018 Aug 7;8:301. doi: 10.3389/fonc.2018.00301. eCollection 2018.
• [12] APRIL promotes breast tumor growth and metastasis and is associated with aggressive basal breast cancer.Carcinogenesis. 2015 May;36(5):574-84. doi: 10.1093/carcin/bgv020. Epub 2015 Mar 6.
• [13] Hodgkin lymphoma cells express TACI and BCMA receptors and generate survival and proliferation signals in response to BAFF and APRIL.Blood. 2007 Jan 15;109(2):729-39. doi: 10.1182/blood-2006-04-015958. Epub 2006 Sep 7.
• [14] Detection of the TNFSF members BAFF, APRIL, TWEAK and their receptors in normal kidney and renal cell carcinomas.Anal Cell Pathol (Amst). 2011;34(1-2):49-60. doi: 10.3233/ACP-2011-0001.
• [15] Reduced APRIL expression induces cellular senescence via a HSPG-dependent pathway.Pathol Oncol Res. 2009 Dec;15(4):693-701. doi: 10.1007/s12253-009-9172-y. Epub 2009 May 26.
• [16] Amelioration of colorectal cancer using negative lipidoid nanoparticles to encapsulate siRNA against APRIL by enema delivery mode.Pathol Oncol Res. 2014 Oct;20(4):953-64. doi: 10.1007/s12253-014-9779-5. Epub 2014 Apr 26.
• [17] APRIL induces cisplatin resistance in gastric cancer cells via activation of the NF-B pathway.Cell Physiol Biochem. 2015;35(2):571-85. doi: 10.1159/000369720. Epub 2015 Jan 27.
• [18] Synergisic effect of APRIL knockdown and Jiedu Xiaozheng Yin, a Chinese medicinal recipe, on the inhibition of hepatocellular carcinoma cell proliferation.Oncol Rep. 2017 Feb;37(2):754-760. doi: 10.3892/or.2016.5339. Epub 2016 Dec 28.
• [19] Toll-Like Receptor 9 Stimulation Induces Aberrant Expression of a Proliferation-Inducing Ligand by Tonsillar Germinal Center B Cells in IgA Nephropathy.J Am Soc Nephrol. 2017 Apr;28(4):1227-1238. doi: 10.1681/ASN.2016050496. Epub 2016 Dec 5.
• [20] Altered circulating levels of B cell growth factors and their modulation upon anti-tuberculosis treatment in pulmonary tuberculosis and tuberculous lymphadenitis.PLoS One. 2018 Nov 14;13(11):e0207404. doi: 10.1371/journal.pone.0207404. eCollection 2018.
• [21] Chronic lymphocytic leukemia disease progression is accelerated by APRIL-TACI interaction in the TCL1 transgenic mouse model.Blood. 2013 Dec 5;122(24):3960-3. doi: 10.1182/blood-2013-04-497693. Epub 2013 Oct 7.
• [22] Two Gln187 mutants of human soluble APRIL inhibit proliferation of lung carcinoma A549 cells.Acta Biochim Pol. 2009;56(4):703-10. Epub 2009 Dec 7.
• [23] TACI-dependent APRIL signaling maintains autoreactive B cells in a mouse model of systemic lupus erythematosus.Eur J Immunol. 2017 Apr;47(4):713-723. doi: 10.1002/eji.201646630.
• [24] A proliferation-inducing ligand-mediated anti-inflammatory response of astrocytes in multiple sclerosis.Ann Neurol. 2019 Mar;85(3):406-420. doi: 10.1002/ana.25415. Epub 2019 Feb 4.
• [25] Characterization of BAFF and APRIL subfamily receptors in rainbow trout (Oncorhynchus mykiss). Potential role of the BAFF / APRIL axis in the pathogenesis of proliferative kidney disease.PLoS One. 2017 Mar 21;12(3):e0174249. doi: 10.1371/journal.pone.0174249. eCollection 2017.
• [26] APRIL promotes non-small cell lung cancer growth and metastasis by targeting ERK1/2 signaling.Oncotarget. 2017 Nov 27;8(65):109289-109300. doi: 10.18632/oncotarget.22672. eCollection 2017 Dec 12.
• [27] A BAFF/APRIL-dependent TLR3-stimulated pathway enhances the capacity of rheumatoid synovial fibroblasts to induce AID expression and Ig class-switching in B cells.Ann Rheum Dis. 2011 Oct;70(10):1857-65. doi: 10.1136/ard.2011.150219. Epub 2011 Jul 27.
• [28] The emerging roles of B cells as partners and targets in periodontitis.Autoimmunity. 2017 Feb;50(1):61-70. doi: 10.1080/08916934.2016.1261841. Epub 2016 Dec 26.
• [29] APRIL signaling via TACI mediates immunosuppression by T regulatory cells in multiple myeloma: therapeutic implications.Leukemia. 2019 Feb;33(2):426-438. doi: 10.1038/s41375-018-0242-6. Epub 2018 Aug 22.
• [30] The role of BAFF and APRIL in rheumatoid arthritis.J Cell Physiol. 2019 Aug;234(10):17050-17063. doi: 10.1002/jcp.28445. Epub 2019 Apr 2.
• [31] B-cell maturation antigen (BCMA) activation exerts specific proinflammatory effects in normal human keratinocytes and is preferentially expressed in inflammatory skin pathologies.Endocrinology. 2012 Feb;153(2):739-49. doi: 10.1210/en.2011-1504. Epub 2011 Dec 13.
• [32] APRIL gene expression in a cohort of Egyptian acute myeloid leukemia patients: Clinical and prognostic significance.Cancer Genet. 2018 Jan;220:24-31. doi: 10.1016/j.cancergen.2017.10.003. Epub 2017 Oct 24.
• [33] B cell activation through CD40 and IL4R ligation modulates the response of chronic lymphocytic leukaemia cells to BAFF and APRIL.Br J Haematol. 2014 Feb;164(4):570-8. doi: 10.1111/bjh.12645. Epub 2013 Nov 18.
• [34] The tumour necrosis factor superfamily ligand APRIL (TNFSF13) is released upon platelet activation and expressed in atherosclerosis.Thromb Haemost. 2009 Oct;102(4):704-10. doi: 10.1160/TH08-10-0665.
• [35] APRIL, a proliferation-inducing ligand, as a potential marker of lupus nephritis.Arthritis Res Ther. 2012 Nov 21;14(6):R252. doi: 10.1186/ar4095.
• [36] Differential Roles of Tumor Necrosis Factor Ligand Superfamily Members as Biomarkers in Pancreatic Cancer.J Clin Med. 2018 Jul 13;7(7):175. doi: 10.3390/jcm7070175.
• [37] BAFF-R and TACI expression on CD3+ T cells: Interplay among BAFF, APRIL and T helper cytokines profile in systemic lupus erythematosus.Cytokine. 2019 Feb;114:115-127. doi: 10.1016/j.cyto.2018.11.008. Epub 2018 Nov 19.
• [38] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [39] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [40] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [41] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [42] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [43] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [44] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [45] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [46] Cannabidiol Activates Neuronal Precursor Genes in Human Gingival Mesenchymal Stromal Cells. J Cell Biochem. 2017 Jun;118(6):1531-1546. doi: 10.1002/jcb.25815. Epub 2016 Dec 29.
• [47] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [48] Proteomic profile of aminoglutethimide-induced apoptosis in HL-60 cells: role of myeloperoxidase and arylamine free radicals. Chem Biol Interact. 2015 Sep 5;239:129-38.
• [49] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [50] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [51] Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
• [52] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [53] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [54] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.